Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NTSR2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit NTSR2 Polyclonal Antibody | anti-NTSR2 antibody

NTSR2 antibody - C-terminal region

Gene Names
NTSR2; NTR2
Reactivity
Horse, Human, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NTSR2; Polyclonal Antibody; NTSR2 antibody - C-terminal region; anti-NTSR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFLNGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVWKKTF
Sequence Length
410
Applicable Applications for anti-NTSR2 antibody
Western Blot (WB)
Homology
Horse: 77%; Human: 100%; Yeast: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NTSR2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-NTSR2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-NTSR2 antibody
This is a rabbit polyclonal antibody against NTSR2. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the G protein-coupled receptor family that activate a phosphatidylinositol-calcium second messenger system. Binding and pharmacological studies demonstrate that this receptor binds neurotensin as well as several other ligands already described for neurotensin NT1 receptor. However, unlike NT1 receptor, this gene recognizes, with high affinity, levocabastine, a histamine H1 receptor antagonist previously shown to compete with neurotensin for low-affinity binding sites in brain. These activities suggest that this receptor may be of physiological importance and that a natural agonist for the receptor may exist.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
neurotensin receptor type 2
NCBI Official Synonym Full Names
neurotensin receptor 2
NCBI Official Symbol
NTSR2
NCBI Official Synonym Symbols
NTR2
NCBI Protein Information
neurotensin receptor type 2
UniProt Protein Name
Neurotensin receptor type 2
Protein Family
UniProt Gene Name
NTSR2
UniProt Synonym Gene Names
NT-R-2; NTR2
UniProt Entry Name
NTR2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the G protein-coupled receptor family that activate a phosphatidylinositol-calcium second messenger system. Binding and pharmacological studies demonstrate that this receptor binds neurotensin as well as several other ligands already described for neurotensin NT1 receptor. However, unlike NT1 receptor, this gene recognizes, with high affinity, levocabastine, a histamine H1 receptor antagonist previously shown to compete with neurotensin for low-affinity binding sites in brain. These activities suggest that this receptor may be of physiological importance and that a natural agonist for the receptor may exist. [provided by RefSeq, Jul 2008]

Uniprot Description

NTSR2: neurotensin receptor 2

Protein type: Membrane protein, integral; Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2p25.1

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; neurotensin receptor activity, G-protein coupled

Biological Process: regulation of membrane potential; cell surface receptor linked signal transduction; neuropeptide signaling pathway; sensory perception; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating)

Research Articles on NTSR2

Similar Products

Product Notes

The NTSR2 ntsr2 (Catalog #AAA3216310) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NTSR2 antibody - C-terminal region reacts with Horse, Human, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's NTSR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NTSR2 ntsr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFLNGVTVSH LLALCSQVPS TSTPGSSTPS RLELLSEEGL LSFIVWKKTF. It is sometimes possible for the material contained within the vial of "NTSR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.