Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Il15ra AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

Rabbit Il15ra Polyclonal Antibody | anti-IL15RA antibody

Il15ra antibody - N-terminal region

Gene Names
Il15ra; IL-15RA; AA690181
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Il15ra; Polyclonal Antibody; Il15ra antibody - N-terminal region; anti-IL15RA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDP
Sequence Length
263
Applicable Applications for anti-IL15RA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Il15ra AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

Western Blot (WB) (WB Suggested Anti-Il15ra AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Related Product Information for anti-IL15RA antibody
This is a rabbit polyclonal antibody against Il15ra. It was validated on Western Blot

Target Description: Il15ra is a high-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Signal transduction seems to involve STAT3, STAT5, STAT6, JAK2 and SYK. Expression of different isoforms may alter or interfere with signal transduction.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
interleukin-15 receptor subunit alpha isoform 1
NCBI Official Synonym Full Names
interleukin 15 receptor, alpha chain
NCBI Official Symbol
Il15ra
NCBI Official Synonym Symbols
IL-15RA; AA690181
NCBI Protein Information
interleukin-15 receptor subunit alpha
UniProt Protein Name
Interleukin-15 receptor subunit alpha
Protein Family
UniProt Gene Name
Il15ra
UniProt Synonym Gene Names
IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA
UniProt Entry Name
I15RA_MOUSE

Uniprot Description

IL15RA: High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 and SYK. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Cellular Component: membrane; integral to membrane; plasma membrane; extracellular region; cytoplasmic vesicle; intracellular; nucleus

Biological Process: positive regulation of natural killer cell differentiation; JAK-STAT cascade

Research Articles on IL15RA

Similar Products

Product Notes

The IL15RA il15ra (Catalog #AAA3216051) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Il15ra antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Il15ra can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL15RA il15ra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NYSVNSRERY VCNSGFKRKA GTSTLIECVI NKNTNVAHWT TPSLKCIRDP. It is sometimes possible for the material contained within the vial of "Il15ra, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.