Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HRH2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit HRH2 Polyclonal Antibody | anti-HRH2 antibody

HRH2 Antibody - C-terminal region

Gene Names
HRH2; H2R; HH2R
Reactivity
Dog, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HRH2; Polyclonal Antibody; HRH2 Antibody - C-terminal region; anti-HRH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQ
Sequence Length
359
Applicable Applications for anti-HRH2 antibody
Western Blot (WB)
Homology
Dog: 77%; Horse: 79%; Human: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HRH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HRH2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-HRH2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-HRH2 antibody
This is a rabbit polyclonal antibody against HRH2. It was validated on Western Blot

Target Description: Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. Histamine receptor H2 belongs to the family 1 of G protein-coupled receptors. It is an integral membrane protein and stimulates gastric acid secretion. It also regulates gastrointestinal motility and intestinal secretion and is thought to be involved in regulating cell growth and differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Synonym Full Names
histamine receptor H2
NCBI Official Symbol
HRH2
NCBI Official Synonym Symbols
H2R; HH2R
NCBI Protein Information
histamine H2 receptor
UniProt Protein Name
Histamine H2 receptor
Protein Family
UniProt Gene Name
HRH2
UniProt Synonym Gene Names
H2R; HH2R
UniProt Entry Name
HRH2_HUMAN

NCBI Description

Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. Histamine receptor H2 belongs to the family 1 of G protein-coupled receptors. It is an integral membrane protein and stimulates gastric acid secretion. It also regulates gastrointestinal motility and intestinal secretion and is thought to be involved in regulating cell growth and differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

H2R: The H2 subclass of histamine receptors mediates gastric acid secretion. Also appears to regulate gastrointestinal motility and intestinal secretion. Possible role in regulating cell growth and differentiation. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and, through a separate G protein-dependent mechanism, the phosphoinositide/protein kinase (PKC) signaling pathway. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 5q35.2

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: histamine receptor activity

Biological Process: G-protein signaling, coupled to cyclic nucleotide second messenger; gland development; gastrin-induced gastric acid secretion; histamine-induced gastric acid secretion; gut development; positive regulation of vasoconstriction; visual learning; regulation of synaptic plasticity; immune response; memory

Research Articles on HRH2

Similar Products

Product Notes

The HRH2 hrh2 (Catalog #AAA3216828) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HRH2 Antibody - C-terminal region reacts with Dog, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HRH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HRH2 hrh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFRTGYQQLF CCRLANRNSH KTSLRSNASQ LSRTQSREPR QQEEKPLKLQ. It is sometimes possible for the material contained within the vial of "HRH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.