Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD6 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)

Rabbit CD6 Polyclonal Antibody | anti-CD6 antibody

CD6 antibody - C-terminal region

Gene Names
CD6; TP120
Reactivity
Cow, Dog, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD6; Polyclonal Antibody; CD6 antibody - C-terminal region; anti-CD6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYD
Sequence Length
668
Applicable Applications for anti-CD6 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 85%; Human: 100%; Rabbit: 85%; Rat: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD6 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CD6 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)
Related Product Information for anti-CD6 antibody
This is a rabbit polyclonal antibody against CD6. It was validated on Western Blot

Target Description: This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion molecule. The gene product is important for continuation of T cell activation. This gene may be associated with susceptibility to multiple sclerosis. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
923
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
T-cell differentiation antigen CD6 isoform 1
NCBI Official Synonym Full Names
CD6 molecule
NCBI Official Symbol
CD6
NCBI Official Synonym Symbols
TP120
NCBI Protein Information
T-cell differentiation antigen CD6
UniProt Protein Name
T-cell differentiation antigen CD6
Protein Family
UniProt Gene Name
CD6
UniProt Entry Name
CD6_HUMAN

NCBI Description

This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion molecule. The gene product is important for continuation of T cell activation. This gene may be associated with susceptibility to multiple sclerosis (PMID: 19525953, 21849685). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

CD6: a type I membrane protein involved in cell adhesion. Binds to CD166. Expressed on thymocytes, peripheral T cells, a subset of B cells, and a subset of neurons. Mediates the binding of developing thymocytes with thymic epithelial cells. CD6- T cells are less autoreactive than CD6+ T cells. Phosphorylated on tyrosines and serines following T cell antigen receptor signaling. Five splice-variant isoforms have been described.

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: integral to plasma membrane

Molecular Function: protein binding; scavenger receptor activity

Biological Process: receptor-mediated endocytosis; cell adhesion

Research Articles on CD6

Similar Products

Product Notes

The CD6 cd6 (Catalog #AAA3215977) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD6 antibody - C-terminal region reacts with Cow, Dog, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD6 cd6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GPPADDSSST SSGEWYQNFQ PPPQPPSEEQ FGCPGSPSPQ PDSTDNDDYD. It is sometimes possible for the material contained within the vial of "CD6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.