Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NRXN3Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human NRXN3 Polyclonal Antibody | anti-NRXN3 antibody

NRXN3 Antibody - C-terminal region

Gene Names
NRXN3; C14orf60
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NRXN3; Polyclonal Antibody; NRXN3 Antibody - C-terminal region; anti-NRXN3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YKYRNRDEGSYQVDETRNYISNSAQSNGTLMKEKQQSSKSGHKKQKNKDR
Sequence Length
167
Applicable Applications for anti-NRXN3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NRXN3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NRXN3Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NRXN3Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NRXN3 antibody
This gene encodes a member of a family of proteins that function in the nervous system as receptors and cell adhesion molecules. Extensive alternative splicing and the use of alternative promoters results in multiple transcript variants and protein isoforms for this gene, but the full-length nature of many of these variants has not been determined. Transcripts that initiate from an upstream promoter encode alpha isoforms, which contain epidermal growth factor-like (EGF-like) sequences and laminin G domains. Transcripts initiating from the downstream promoter encode beta isoforms, which lack EGF-like sequences. Genetic variation at this locus has been associated with a range of behavioral phenotypes, including alcohol dependence and autism spectrum disorder.
Product Categories/Family for anti-NRXN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69 kDa
NCBI Official Full Name
neurexin 3 isoform 1
NCBI Official Synonym Full Names
neurexin 3
NCBI Official Symbol
NRXN3
NCBI Official Synonym Symbols
C14orf60
NCBI Protein Information
neurexin 3
UniProt Protein Name
Neurexin-3
Protein Family
UniProt Gene Name
NRXN3
UniProt Synonym Gene Names
C14orf60; KIAA0743
UniProt Entry Name
NRX3A_HUMAN

NCBI Description

This gene encodes a member of a family of proteins that function in the nervous system as receptors and cell adhesion molecules. Extensive alternative splicing and the use of alternative promoters results in multiple transcript variants and protein isoforms for this gene, but the full-length nature of many of these variants has not been determined. Transcripts that initiate from an upstream promoter encode alpha isoforms, which contain epidermal growth factor-like (EGF-like) sequences and laminin G domains. Transcripts initiating from the downstream promoter encode beta isoforms, which lack EGF-like sequences. Genetic variation at this locus has been associated with a range of behavioral phenotypes, including alcohol dependence and autism spectrum disorder. [provided by RefSeq, Dec 2012]

Uniprot Description

NRXN3: Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May mediate intracellular signaling. Belongs to the neurexin family. 7 isoforms of the human protein are produced by alternative promoter.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 14q31

Cellular Component: integral to plasma membrane; integral to membrane

Molecular Function: metal ion binding; calcium channel regulator activity; receptor activity; cell adhesion molecule binding

Biological Process: positive regulation of synaptogenesis; axon guidance; synaptic transmission; synaptogenesis; neurotransmitter secretion; adult behavior; neuron adhesion; learning; angiogenesis; social behavior

Research Articles on NRXN3

Similar Products

Product Notes

The NRXN3 nrxn3 (Catalog #AAA3220484) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NRXN3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NRXN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NRXN3 nrxn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YKYRNRDEGS YQVDETRNYI SNSAQSNGTL MKEKQQSSKS GHKKQKNKDR. It is sometimes possible for the material contained within the vial of "NRXN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.