Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NMNAT1Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)

Rabbit NMNAT1 Polyclonal Antibody | anti-NMNAT1 antibody

NMNAT1 antibody - N-terminal region

Gene Names
NMNAT1; LCA9; NMNAT; PNAT1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
NMNAT1; Polyclonal Antibody; NMNAT1 antibody - N-terminal region; anti-NMNAT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL
Sequence Length
279
Applicable Applications for anti-NMNAT1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Goat: 79%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NMNAT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NMNAT1Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NMNAT1Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-NMNAT1 Antibody Titration: 0.25ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-NMNAT1 Antibody Titration: 0.25ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-NMNAT1 antibody
This is a rabbit polyclonal antibody against NMNAT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD (Zhang et al., 2003 [PubMed 12574164]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 isoform 1
NCBI Official Synonym Full Names
nicotinamide nucleotide adenylyltransferase 1
NCBI Official Symbol
NMNAT1
NCBI Official Synonym Symbols
LCA9; NMNAT; PNAT1
NCBI Protein Information
nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
UniProt Protein Name
Nicotinamide mononucleotide adenylyltransferase 1
UniProt Gene Name
NMNAT1
UniProt Synonym Gene Names
NMNAT; NMN adenylyltransferase 1; NaMN adenylyltransferase 1
UniProt Entry Name
NMNA1_HUMAN

NCBI Description

This gene encodes an enzyme which catalyzes a key step in the biosynthesis of nicotinamide adenine dinucleotide (NAD). The encoded enzyme is one of several nicotinamide nucleotide adenylyltransferases, and is specifically localized to the cell nucleus. Activity of this protein leads to the activation of a nuclear deacetylase that functions in the protection of damaged neurons. Mutations in this gene have been associated with Leber congenital amaurosis 9. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are located on chromosomes 1, 3, 4, 14, and 15. [provided by RefSeq, Jul 2014]

Uniprot Description

NMNAT1: Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency. Can use triazofurin monophosphate (TrMP) as substrate. Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+). For the pyrophosphorolytic activity, prefers NAD(+) and NAAD as substrates and degrades NADH, nicotinic acid adenine dinucleotide phosphate (NHD) and nicotinamide guanine dinucleotide (NGD) less effectively. Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NAADP(+). Protects against axonal degeneration following mechanical or toxic insults. Belongs to the eukaryotic NMN adenylyltransferase family.

Protein type: EC 2.7.7.18; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; Transferase; EC 2.7.7.1

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; nicotinamide-nucleotide adenylyltransferase activity; nicotinate-nucleotide adenylyltransferase activity; ATP binding

Biological Process: NAD biosynthetic process; vitamin metabolic process; NAD metabolic process; water-soluble vitamin metabolic process

Disease: Leber Congenital Amaurosis 9

Research Articles on NMNAT1

Similar Products

Product Notes

The NMNAT1 nmnat1 (Catalog #AAA3209223) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NMNAT1 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NMNAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NMNAT1 nmnat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVGDAYKKKG LIPAYHRVIM AELATKNSKW VEVDTWESLQ KEWKETLKVL. It is sometimes possible for the material contained within the vial of "NMNAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.