Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NFE2L2 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: A172 cell lysateNFE2L2 is supported by BioGPS gene expression data to be expressed in A172)

Rabbit NFE2L2 Polyclonal Antibody | anti-NFE2L2 antibody

NFE2L2 antibody - C-terminal region

Gene Names
NFE2L2; NRF2; HEBP1; IMDDHH
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
NFE2L2; Polyclonal Antibody; NFE2L2 antibody - C-terminal region; anti-NFE2L2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGN
Sequence Length
605
Applicable Applications for anti-NFE2L2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NFE2L2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NFE2L2 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: A172 cell lysateNFE2L2 is supported by BioGPS gene expression data to be expressed in A172)

Western Blot (WB) (WB Suggested Anti-NFE2L2 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: A172 cell lysateNFE2L2 is supported by BioGPS gene expression data to be expressed in A172)
Related Product Information for anti-NFE2L2 antibody
This is a rabbit polyclonal antibody against NFE2L2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NFE2 (MIM 601490), NFE2L1 (MIM 163260), and NFE2L2 comprise a family of human genes encoding basic leucine zipper (bZIP) transcription factors. They share highly conserved regions that are distinct from other bZIP families, such as JUN (MIM 165160) and FOS (MIM 164810), although remaining regions have diverged considerably from each other. NFE2L2 may be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region.NFE2 (MIM 601490), NFE2L1 (MIM 163260), and NFE2L2 comprise a family of human genes encoding basic leucine zipper (bZIP) transcription factors. They share highly conserved regions that are distinct from other bZIP families, such as JUN (MIM 165160) and FOS (MIM 164810), although remaining regions have diverged considerably from each other (Chan et al., 1995).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
nuclear factor erythroid 2-related factor 2 isoform 2
NCBI Official Synonym Full Names
nuclear factor, erythroid 2 like 2
NCBI Official Symbol
NFE2L2
NCBI Official Synonym Symbols
NRF2; HEBP1; IMDDHH
NCBI Protein Information
nuclear factor erythroid 2-related factor 2
UniProt Protein Name
Nuclear factor erythroid 2-related factor 2
UniProt Gene Name
NFE2L2
UniProt Synonym Gene Names
NRF2; NF-E2-related factor 2
UniProt Entry Name
NF2L2_HUMAN

NCBI Description

This gene encodes a transcription factor which is a member of a small family of basic leucine zipper (bZIP) proteins. The encoded transcription factor regulates genes which contain antioxidant response elements (ARE) in their promoters; many of these genes encode proteins involved in response to injury and inflammation which includes the production of free radicals. Multiple transcript variants encoding different isoforms have been characterized for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

NRF2: a transcription factor that regulates basal expression and antioxidant induction of a transcription factor for NAD(P)H:quinone oxidoreductase-1 (NQO1) and other detoxifying genes. Targeted for proteasomal degradation by INrf2. Oxidative stress causes its phosphorylation and release from INrf2.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 2q31

Cellular Component: nucleoplasm; centrosome; cytoplasm; plasma membrane; nucleus; chromatin; cytosol

Molecular Function: protein domain specific binding; protein binding; DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; proteasomal ubiquitin-dependent protein catabolic process; positive regulation of blood coagulation; unfolded protein response; regulation of embryonic development; proteasomal ubiquitin-independent protein catabolic process; protein ubiquitination; positive regulation of transcription from RNA polymerase II promoter

Research Articles on NFE2L2

Similar Products

Product Notes

The NFE2L2 nfe2l2 (Catalog #AAA3204254) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFE2L2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFE2L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NFE2L2 nfe2l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEKGENDKSL HLLKKQLSTL YLEVFSMLRD EDGKPYSPSE YSLQQTRDGN. It is sometimes possible for the material contained within the vial of "NFE2L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.