Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: VAPASample Tissue: Human HeLa Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human VAPA Polyclonal Antibody | anti-VAPA antibody

VAPA Antibody - middle region

Gene Names
VAPA; VAP-A; VAP33; VAP-33; hVAP-33
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
VAPA; Polyclonal Antibody; VAPA Antibody - middle region; anti-VAPA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLN
Sequence Length
249
Applicable Applications for anti-VAPA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human VAPA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: VAPASample Tissue: Human HeLa Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: VAPASample Tissue: Human HeLa Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-VAPA antibody
The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Product Categories/Family for anti-VAPA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27 kDa
NCBI Official Full Name
vesicle-associated membrane protein-associated protein A isoform 1
NCBI Official Synonym Full Names
VAMP associated protein A
NCBI Official Symbol
VAPA
NCBI Official Synonym Symbols
VAP-A; VAP33; VAP-33; hVAP-33
NCBI Protein Information
vesicle-associated membrane protein-associated protein A
UniProt Protein Name
Vesicle-associated membrane protein-associated protein A
UniProt Gene Name
VAPA
UniProt Synonym Gene Names
VAP33; VAMP-A; VAMP-associated protein A; VAP-A; VAP-33

NCBI Description

The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

Binds to OSBPL3, which mediates recruitment of VAPA to plasma membrane sites (PubMed:25447204). The ORP3-VAPA complex stimulates RRAS signaling which in turn attenuates integrin beta-1 (ITGB1) activation at the cell surface (PubMed:25447204). With OSBPL3, may regulate ER morphology (PubMed:16143324). May play a role in vesicle trafficking (PubMed:11511104, PubMed:19289470).

Research Articles on VAPA

Similar Products

Product Notes

The VAPA vapa (Catalog #AAA3221609) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VAPA Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VAPA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VAPA vapa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DELMDSKLRC VFEMPNENDK LNDMEPSKAV PLNASKQDGP MPKPHSVSLN. It is sometimes possible for the material contained within the vial of "VAPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.