Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Neuroplastin antibody (MBS5300399) used at 1 ug/ml to detect target protein.)

Rabbit Neuroplastin Polyclonal Antibody | anti-Nptn antibody

Neuroplastin antibody

Gene Names
Nptn; Sdfr1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Neuroplastin; Polyclonal Antibody; Neuroplastin antibody; Polyclonal Neuroplastin; Anti-Neuroplastin; SDR1; np55; MGC102805; np65; GP55; NPTN; SDFR1; DKFZp686L2477; GP65; anti-Nptn antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Neuroplastin antibody was raised against the middle region of NPTN
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NPTN antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
393
Applicable Applications for anti-Nptn antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Neuroplastin antibody (MBS5300399) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Neuroplastin antibody (MBS5300399) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-Nptn antibody
Rabbit polyclonal Neuroplastin antibody raised against the middle region of NPTN
Product Categories/Family for anti-Nptn antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29 kDa (MW of target protein)
NCBI Official Full Name
neuroplastin
NCBI Official Synonym Full Names
neuroplastin
NCBI Official Symbol
Nptn
NCBI Official Synonym Symbols
Sdfr1
NCBI Protein Information
neuroplastin
UniProt Protein Name
Neuroplastin
Protein Family
UniProt Gene Name
Nptn
UniProt Synonym Gene Names
Sdfr1; Sdr1; gp55/65; SDR-1
UniProt Entry Name
NPTN_RAT

NCBI Description

synaptic membrane glycoprotein that is a member of the immunoglobulin (Ig) superfamily [RGD, Feb 2006]

Uniprot Description

neuroplastin: Probable homophilic and heterophilic cell adhesion molecule involved in long term potentiation at hippocampal excitatory synapses through activation of p38MAPK. May also regulate neurite outgrowth by activating the FGFR1 signaling pathway. May play a role in synaptic plasticity. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Membrane protein, integral

Cellular Component: presynaptic membrane; postsynaptic membrane; cell surface; integral to membrane

Molecular Function: cell adhesion molecule binding; transmembrane receptor protein tyrosine kinase activity; ATP binding; type 1 fibroblast growth factor receptor binding

Biological Process: regulation of cell adhesion; elevation of cytosolic calcium ion concentration; peptidyl-tyrosine phosphorylation; positive regulation of fibroblast growth factor receptor signaling pathway; positive regulation of protein amino acid phosphorylation; homophilic cell adhesion; positive regulation of long-term neuronal synaptic plasticity; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on Nptn

Similar Products

Product Notes

The Nptn nptn (Catalog #AAA5300399) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Neuroplastin antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Neuroplastin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the Nptn nptn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Neuroplastin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.