Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-METTL2B Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit METTL2B Polyclonal Antibody | anti-METTL2B antibody

METTL2B antibody - N-terminal region

Gene Names
METTL2B; METL; METTL2; METTL2A; PSENIP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
METTL2B; Polyclonal Antibody; METTL2B antibody - N-terminal region; anti-METTL2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS
Sequence Length
378
Applicable Applications for anti-METTL2B antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 75%; Pig: 93%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human METTL2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-METTL2B Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-METTL2B Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-METTL2B antibody
This is a rabbit polyclonal antibody against METTL2B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases.This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Product Categories/Family for anti-METTL2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
methyltransferase-like protein 2B
NCBI Official Synonym Full Names
methyltransferase like 2B
NCBI Official Symbol
METTL2B
NCBI Official Synonym Symbols
METL; METTL2; METTL2A; PSENIP1
NCBI Protein Information
methyltransferase-like protein 2B
UniProt Protein Name
Methyltransferase-like protein 2B
UniProt Gene Name
METTL2B
UniProt Entry Name
MET2B_HUMAN

NCBI Description

This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

METTL2B: Probable methyltransferase. Belongs to the methyltransferase superfamily. METL family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.1.1.-; Amino Acid Metabolism - tyrosine; Other Amino Acids Metabolism - selenoamino acid; Amino Acid Metabolism - histidine; Lipid Metabolism - androgen and estrogen; Methyltransferase

Chromosomal Location of Human Ortholog: 7q32.1

Molecular Function: tRNA (cytosine)-methyltransferase activity

Biological Process: tRNA methylation

Similar Products

Product Notes

The METTL2B mettl2b (Catalog #AAA3209195) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The METTL2B antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's METTL2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the METTL2B mettl2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: INAHKYWNDF YKIHENGFFK DRHWLFTEFP ELAPSQNQNH LKDWFLENKS. It is sometimes possible for the material contained within the vial of "METTL2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.