Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Myotrophin antibody (MBS5301357) used at 1 ug/ml to detect target protein.)

Rabbit Myotrophin Polyclonal Antibody | anti-MTPN antibody

Myotrophin antibody

Gene Names
MTPN; V-1; GCDP
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot
Purity
Affinity purified
Synonyms
Myotrophin; Polyclonal Antibody; Myotrophin antibody; Polyclonal Myotrophin; Anti-Myotrophin; V-1; MTPN; GCDP; FLJ31098; anti-MTPN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
Myotrophin antibody was raised against the middle region of MTPN
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTPN antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
118
Applicable Applications for anti-MTPN antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
MTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
Myotrophin antibody was raised using the middle region of MTPN corresponding to a region with amino acids GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Myotrophin antibody (MBS5301357) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Myotrophin antibody (MBS5301357) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-MTPN antibody
Rabbit polyclonal Myotrophin antibody raised against the middle region of MTPN
Product Categories/Family for anti-MTPN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13 kDa (MW of target protein)
NCBI Official Full Name
myotrophin
NCBI Official Synonym Full Names
myotrophin
NCBI Official Symbol
MTPN
NCBI Official Synonym Symbols
V-1; GCDP
NCBI Protein Information
myotrophin
UniProt Protein Name
Myotrophin
Protein Family
UniProt Gene Name
MTPN
UniProt Entry Name
MTPN_HUMAN

NCBI Description

The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq, Jul 2008]

Uniprot Description

MTPN: Promotes dimerization of NF-kappa-B subunits and regulates NF-kappa-B transcription factor activity. Plays a role in the regulation of the growth of actin filaments. Inhibits the activity of the F-actin-capping protein complex formed by the CAPZA1 and CAPZB heterodimer. Promotes growth of cardiomyocytes, but not cardiomyocyte proliferation. Promotes cardiac muscle hypertrophy. Belongs to the myotrophin family.

Chromosomal Location of Human Ortholog: 7q33

Cellular Component: F-actin capping protein complex; axon; perinuclear region of cytoplasm; nucleus; cytosol

Biological Process: regulation of translation; neuron differentiation; catecholamine metabolic process; striated muscle cell differentiation; skeletal muscle regeneration; cell growth; positive regulation of cell growth; cerebellar granule cell differentiation; positive regulation of protein metabolic process; activation of NF-kappaB transcription factor; regulation of striated muscle development

Research Articles on MTPN

Similar Products

Product Notes

The MTPN mtpn (Catalog #AAA5301357) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Myotrophin antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's Myotrophin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the MTPN mtpn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Myotrophin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.