Mouse anti-Human MTPN Monoclonal Antibody | anti-MTPN antibody

MTPN (Myotrophin, FLJ31098, FLJ99857)

Cat. Num. AAA6003693

• Gene Names: MTPN; V-1; GCDP
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: MTPN; Monoclonal Antibody; MTPN (Myotrophin; FLJ31098; FLJ99857); Anti -MTPN (Myotrophin; anti-MTPN antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F3
• Specificity: Recognizes human MTPN.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MCDKEFMWALKNGGLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ

• Applicable Applications for anti-MTPN antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant protein corresponding to aa1-119 from human MTPN (AAH28093) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (39.09kD).)

Western Blot (WB)

(Western Blot analysis of MTPN expression in transfected 293T cell line by MTPN monoclonal antibody. Lane 1: MTPN transfected lysate (12.9kD).|Lane 2: Non-transfected lysate.)

Related Product Information for anti-MTPN antibody

Potential role in cerebellar morphogenesis. May function in differentiation of cerebellar neurons, particularly of granule cells. Seems to be associated with cardiac hypertrophy.

Product Categories/Family for anti-MTPN antibody

Antibodies; Abs to Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 21956645
• NCBI GeneID: 136319
• NCBI Accession #: NP_665807.1
• NCBI GenBank Nucleotide #: NM_145808.3
• UniProt Accession #: P58546
• Molecular Weight: 12,895 Da
• NCBI Official Full Name: myotrophin
• NCBI Official Synonym Full Names: myotrophin
• NCBI Official Symbol: MTPN
• NCBI Official Synonym Symbols: V-1; GCDP
• NCBI Protein Information: myotrophin; protein V-1; granule cell differentiation protein
• UniProt Protein Name: Myotrophin
• Protein Family: Myotrophin
• UniProt Gene Name: MTPN
• UniProt Entry Name: MTPN_HUMAN

NCBI Description

The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq, Jul 2008]

Uniprot Description

MTPN: Promotes dimerization of NF-kappa-B subunits and regulates NF-kappa-B transcription factor activity. Plays a role in the regulation of the growth of actin filaments. Inhibits the activity of the F-actin-capping protein complex formed by the CAPZA1 and CAPZB heterodimer. Promotes growth of cardiomyocytes, but not cardiomyocyte proliferation. Promotes cardiac muscle hypertrophy. Belongs to the myotrophin family.

Chromosomal Location of Human Ortholog: 7q33

Cellular Component: F-actin capping protein complex; axon; perinuclear region of cytoplasm; nucleus; cytosol

Biological Process: neuron differentiation; regulation of translation; catecholamine metabolic process; striated muscle cell differentiation; skeletal muscle regeneration; cell growth; cerebellar granule cell differentiation; positive regulation of cell growth; positive regulation of protein metabolic process; activation of NF-kappaB transcription factor; regulation of striated muscle development