Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CKMM antibody (MBS839099) used at 1 ug/ml to detect target protein.)

Rabbit CKMM Polyclonal Antibody | anti-CKMM antibody

CKMM antibody

Gene Names
CKM; CKMM; M-CK
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot
Purity
Affinity purified
Synonyms
CKMM; Polyclonal Antibody; CKMM antibody; Polyclonal CKMM; Anti-CKMM; Creatine Kinase Muscle; Creatine Kinase MM Isoenzyme; M-CK; CK MM; anti-CKMM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
CKMM antibody was raised against the middle region of CKM
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CKM antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
381
Applicable Applications for anti-CKMM antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. CKM is a member of the ATP: guanido phosphotransferase protein family.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
CKMM antibody was raised using the middle region of CKM corresponding to a region with amino acids GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(CKMM antibody (MBS839099) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (CKMM antibody (MBS839099) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CKMM antibody
Rabbit polyclonal CKMM antibody raised against the middle region of CKM
Product Categories/Family for anti-CKMM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43 kDa (MW of target protein)
NCBI Official Full Name
creatine kinase M-type
NCBI Official Synonym Full Names
creatine kinase, muscle
NCBI Official Symbol
CKM
NCBI Official Synonym Symbols
CKMM; M-CK
NCBI Protein Information
creatine kinase M-type
UniProt Protein Name
Creatine kinase M-type
UniProt Gene Name
CKM
UniProt Synonym Gene Names
CKMM
UniProt Entry Name
KCRM_HUMAN

NCBI Description

The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq, Jul 2008]

Uniprot Description

CKM: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. Belongs to the ATP:guanido phosphotransferase family.

Protein type: Amino Acid Metabolism - arginine and proline; EC 2.7.3.2; Kinase, other

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: cytosol

Molecular Function: creatine kinase activity; ATP binding

Biological Process: phosphocreatine biosynthetic process; creatine metabolic process; phosphorylation

Research Articles on CKMM

Similar Products

Product Notes

The CKMM ckm (Catalog #AAA839099) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CKMM antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's CKMM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CKMM ckm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CKMM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.