Rabbit anti-Human MTA1 Polyclonal Antibody | anti-MTA1 antibody

MTA1 (Metastasis-associated Protein MTA1) (FITC)

Cat. Num. AAA6386053

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MTA1; Polyclonal Antibody; MTA1 (Metastasis-associated Protein MTA1) (FITC); anti-MTA1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MTA1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
• Sequence Length: 1726

• Applicable Applications for anti-MTA1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human MTA1, aa1-255 (AAH06177.1).
• Immunogen Sequence: MKTRQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGTYLGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MTA1 expression in transfected 293T cell line by MTA1 polyclonal antibody. Lane 1: MTA1 transfected lysate (28.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-MTA1 antibody

May be involved in the regulation of gene expression by covalent modification of histone proteins. Isoform Long is a corepressor of estrogen receptor (ER). Isoform Short binds to ER and sequesters it in the cytoplasm and enhances non-genomic responses of ER.

Product Categories/Family for anti-MTA1 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 13544097
• NCBI GeneID: 9112
• NCBI Official Full Name: Homo sapiens metastasis associated 1, mRNA
• NCBI Official Synonym Full Names: metastasis associated 1
• NCBI Official Symbol: MTA1
• NCBI Protein Information: metastasis-associated protein MTA1
• Protein Family: Mating type protein

NCBI Description

This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]