Western Blot (WB)
(WB Suggested Anti-MRGPRE AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Rabbit anti-Human, Rat MRGPRE Polyclonal Antibody | anti-MRGPRE antibody
MRGPRE antibody - C-terminal region
Gene Names
MRGPRE; MGRF; MRGE; GPR167
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MRGPRE; Polyclonal Antibody; MRGPRE antibody - C-terminal region; anti-MRGPRE antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAKPVVYFCLGSAQGRRLPLRLVLQRALGDEAELGAVRETSRRGLVDIAA
Sequence Length
311
Applicable Applications for anti-MRGPRE antibody
Western Blot (WB)
Homology
Human: 100%; Rat: 91%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MRGPRE AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-MRGPRE AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Related Product Information for anti-MRGPRE antibody
This is a rabbit polyclonal antibody against MRGPRE. It was validated on Western Blot
Target Description: MRGPRE is an orphan receptor. It may regulate nociceptor function and/or development, including the sensation or modulation of pain.
Target Description: MRGPRE is an orphan receptor. It may regulate nociceptor function and/or development, including the sensation or modulation of pain.
Product Categories/Family for anti-MRGPRE antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
mas-related G-protein coupled receptor member E
NCBI Official Synonym Full Names
MAS related GPR family member E
NCBI Official Symbol
MRGPRE
NCBI Official Synonym Symbols
MGRF; MRGE; GPR167
NCBI Protein Information
mas-related G-protein coupled receptor member E
UniProt Protein Name
Mas-related G-protein coupled receptor member E
Protein Family
UniProt Gene Name
MRGPRE
UniProt Synonym Gene Names
GPR167; MRGE
UniProt Entry Name
MRGRE_HUMAN
Uniprot Description
MRGPRE: Orphan receptor. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Belongs to the G-protein coupled receptor 1 family. Mas subfamily.
Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 11p15.4
Cellular Component: plasma membrane; integral to membrane
Molecular Function: G-protein coupled receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway
Similar Products
Product Notes
The MRGPRE mrgpre (Catalog #AAA3215822) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRGPRE antibody - C-terminal region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MRGPRE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MRGPRE mrgpre for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAKPVVYFCL GSAQGRRLPL RLVLQRALGD EAELGAVRET SRRGLVDIAA. It is sometimes possible for the material contained within the vial of "MRGPRE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
