Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MRGPRX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysate)

Rabbit anti-Human MRGPRX2 Polyclonal Antibody | anti-MRGPRX2 antibody

MRGPRX2 antibody - middle region

Gene Names
MRGPRX2; MGRG3; MRGX2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MRGPRX2; Polyclonal Antibody; MRGPRX2 antibody - middle region; anti-MRGPRX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VCVLLWALSLLLSILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVL
Sequence Length
330
Applicable Applications for anti-MRGPRX2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MRGPRX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MRGPRX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-MRGPRX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysate)
Related Product Information for anti-MRGPRX2 antibody
This is a rabbit polyclonal antibody against MRGPRX2. It was validated on Western Blot

Target Description: MRGPRX2 is an orphan receptor. It probably involved in the function of nociceptive neurons. It also may regulate nociceptor function and/or development, including the sensation or modulation of pain. Cortistatin-14 seems to be a high potency ligand at this receptor. Cortistatin has several biological functions including roles in sleep regulation locomotor activity, and cortical function. In receptor-expressing cells, cortistatin-stimulated increases in intracellular Ca2+ but had no effect on basal or forskolin-stimulated cAMP levels, suggesting that this receptor is G(q)-coupled.
Product Categories/Family for anti-MRGPRX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
mas-related G-protein coupled receptor member X2
NCBI Official Synonym Full Names
MAS related GPR family member X2
NCBI Official Symbol
MRGPRX2
NCBI Official Synonym Symbols
MGRG3; MRGX2
NCBI Protein Information
mas-related G-protein coupled receptor member X2
UniProt Protein Name
Mas-related G-protein coupled receptor member X2
UniProt Gene Name
MRGPRX2
UniProt Synonym Gene Names
MRGX2
UniProt Entry Name
MRGX2_HUMAN

Uniprot Description

MRGPRX2: Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Cortistatin-14 seems to be a high potency ligand at this receptor. Cortistatin has several biological functions including roles in sleep regulation locomotor activity, and cortical function. In receptor-expressing cells, cortistatin-stimulated increases in intracellular Ca(2+) but had no effect on basal or forskolin- stimulated cAMP levels, suggesting that this receptor is G(q)- coupled. Belongs to the G-protein coupled receptor 1 family. Mas subfamily.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; neuropeptide binding

Biological Process: positive regulation of cytokinesis; G-protein coupled receptor protein signaling pathway; sensory perception of pain; sleep

Research Articles on MRGPRX2

Similar Products

Product Notes

The MRGPRX2 mrgprx2 (Catalog #AAA3214566) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRGPRX2 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MRGPRX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MRGPRX2 mrgprx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VCVLLWALSL LLSILEGKFC GFLFSDGDSG WCQTFDFITA AWLIFLFMVL. It is sometimes possible for the material contained within the vial of "MRGPRX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.