Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GAJ polyclonal antibody. Western Blot analysis of GAJ expression in human skeletal muscle.)

Mouse anti-Human MND1 Polyclonal Antibody | anti-MND1 antibody

MND1 (GAJ, Meiotic Nuclear Division Protein 1 Homolog)

Gene Names
MND1; GAJ
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MND1; Polyclonal Antibody; MND1 (GAJ; Meiotic Nuclear Division Protein 1 Homolog); Anti -MND1 (GAJ; anti-MND1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GAJ.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID
Applicable Applications for anti-MND1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human GAJ, aa1-206 (AAH32142).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GAJ polyclonal antibody. Western Blot analysis of GAJ expression in human skeletal muscle.)

Western Blot (WB) (GAJ polyclonal antibody. Western Blot analysis of GAJ expression in human skeletal muscle.)

Western Blot (WB)

(Western Blot analysis of MND1 expression in transfected 293T cell line by MND1 polyclonal antibody. Lane 1: GAJ transfected lysate (22.66kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MND1 expression in transfected 293T cell line by MND1 polyclonal antibody. Lane 1: GAJ transfected lysate (22.66kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MND1 antibody
Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis. Stimulates both DMC1- and RAD51-mediated homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.
Product Categories/Family for anti-MND1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,753 Da
NCBI Official Full Name
meiotic nuclear division protein 1 homolog isoform 2
NCBI Official Synonym Full Names
meiotic nuclear divisions 1 homolog (S. cerevisiae)
NCBI Official Symbol
MND1
NCBI Official Synonym Symbols
GAJ
NCBI Protein Information
meiotic nuclear division protein 1 homolog; homolog of yeast MND1
UniProt Protein Name
Meiotic nuclear division protein 1 homolog
Protein Family
UniProt Gene Name
MND1
UniProt Synonym Gene Names
GAJ
UniProt Entry Name
MND1_HUMAN

NCBI Description

The product of the MND1 gene associates with HOP2 (MIM 608665) to form a stable heterodimeric complex that binds DNA and stimulates the recombinase activity of RAD51 (MIM 179617) and DMC1 (MIM 602721) (Chi et al., 2007 [PubMed 17639080]). Both the MND1 and HOP2 genes are indispensable for meiotic recombination.[supplied by OMIM, Mar 2008]

Uniprot Description

MND1: Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis. Stimulates both DMC1- and RAD51-mediated homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks. Belongs to the MND1 family.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 4q31.3

Cellular Component: nucleus

Molecular Function: DNA binding

Biological Process: meiotic cell cycle; DNA recombination

Research Articles on MND1

Similar Products

Product Notes

The MND1 mnd1 (Catalog #AAA6000880) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MND1 (GAJ, Meiotic Nuclear Division Protein 1 Homolog) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MND1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MND1 mnd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSKKKGLSAE EKRTRMMEIF SETKDVFQLK DLEKIAPKEK GITAMSVKEV LQSLVDDGMV DCERIGTSNY YWAFPSKALH ARKHKLEVLE SQLSEGSQKH ASLQKSIEKA KIGRCETEER TRLAKELSSL RDQREQLKAE VEKYKDCDPQ VVEEIRQANK VAKEAANRWT DNIFAIKSWA KRKFGFEENK IDRTFGIPED FDYID. It is sometimes possible for the material contained within the vial of "MND1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.