Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TINAG Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

Rabbit TINAG Polyclonal Antibody | anti-TINAG antibody

TINAG antibody - middle region

Gene Names
TINAG; TIN-AG
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TINAG; Polyclonal Antibody; TINAG antibody - middle region; anti-TINAG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG
Sequence Length
476
Applicable Applications for anti-TINAG antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TINAG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TINAG Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-TINAG Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)
Related Product Information for anti-TINAG antibody
This is a rabbit polyclonal antibody against TINAG. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.
Product Categories/Family for anti-TINAG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54
NCBI Official Full Name
tubulointerstitial nephritis antigen
NCBI Official Synonym Full Names
tubulointerstitial nephritis antigen
NCBI Official Symbol
TINAG
NCBI Official Synonym Symbols
TIN-AG
NCBI Protein Information
tubulointerstitial nephritis antigen
UniProt Protein Name
Tubulointerstitial nephritis antigen
UniProt Gene Name
TINAG
UniProt Synonym Gene Names
TIN-Ag
UniProt Entry Name
TINAG_HUMAN

NCBI Description

This gene encodes a glycoprotein that is restricted within the kidney to the basement membranes underlying the epithelium of Bowman's capsule and proximal and distal tubules. Autoantibodies against this protein are found in sera of patients with tubulointerstital nephritis, membranous nephropathy and anti-glomerular basement membrane nephritis. Ontogeny studies suggest that the expression of this antigen is developmentally regulated in a precise spatial and temporal pattern throughout nephrogenesis. [provided by RefSeq, Nov 2011]

Uniprot Description

Function: Mediates adhesion of proximal tubule epithelial cells via integrins alpha3-beta1 and alphaV-beta3. This is a non catalytic peptidase C1 family protein. Ref.9

Subcellular location: Secreted › extracellular space › extracellular matrix › basement membrane Ref.2 Ref.7.

Tissue specificity: Expressed in the kidney cortex, small intestine and cornea. Ref.1 Ref.2 Ref.7

Developmental stage: Initially observed in the Bowman capsule during early glomerular capillary loop formation in the kidney. In more developmentally mature glomeruli, following transition from early to mid-capillary loop stage, expression is higher in the proximal tubular basement membrane than in the distal basement membrane and Bowman capsule. Ref.10

Post-translational modification: It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus 2 alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both.

Miscellaneous: Antibodies against TINAG are found in sera of patients with tubulointerstitial nephritis, a rare autoimmune disorder that causes acute and chronic renal injury.

Sequence similarities: Belongs to the peptidase C1 family.Contains 1 SMB (somatomedin-B) domain.

Research Articles on TINAG

Similar Products

Product Notes

The TINAG tinag (Catalog #AAA3212032) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TINAG antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TINAG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TINAG tinag for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VAADRIAIQS KGRYTANLSP QNLISCCAKN RHGCNSGSID RAWWYLRKRG. It is sometimes possible for the material contained within the vial of "TINAG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.