Western Blot (WB)
(Host: RabbitTarget Name: MMAASample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
Rabbit MMAA Polyclonal Antibody | anti-MMAA antibody
MMAA antibody - N-terminal region
Gene Names
MMAA; cblA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MMAA; Polyclonal Antibody; MMAA antibody - N-terminal region; anti-MMAA antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQRACLAEAITLVESTHSRKKELAQVLLQKVLLYHREQEQSNKGKPLAFR
Sequence Length
418
Applicable Applications for anti-MMAA antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 86%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MMAASample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MMAASample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-MMAA AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-MMAA AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)
Related Product Information for anti-MMAA antibody
This is a rabbit polyclonal antibody against MMAA. It was validated on Western Blot
Target Description: The protein encoded by this gene is involved in the translocation of cobalamin into the mitochondrion, where it is used in the final steps of adenosylcobalamin synthesis. Adenosylcobalamin is a coenzyme required for the activity of methylmalonyl-CoA mutase. Defects in this gene are a cause of methylmalonic aciduria.
Target Description: The protein encoded by this gene is involved in the translocation of cobalamin into the mitochondrion, where it is used in the final steps of adenosylcobalamin synthesis. Adenosylcobalamin is a coenzyme required for the activity of methylmalonyl-CoA mutase. Defects in this gene are a cause of methylmalonic aciduria.
Product Categories/Family for anti-MMAA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
methylmalonic aciduria type A protein, mitochondrial
NCBI Official Synonym Full Names
metabolism of cobalamin associated A
NCBI Official Symbol
MMAA
NCBI Official Synonym Symbols
cblA
NCBI Protein Information
methylmalonic aciduria type A protein, mitochondrial
UniProt Protein Name
Methylmalonic aciduria type A protein, mitochondrial
Protein Family
UniProt Gene Name
MMAA
UniProt Entry Name
MMAA_HUMAN
NCBI Description
The protein encoded by this gene is involved in the translocation of cobalamin into the mitochondrion, where it is used in the final steps of adenosylcobalamin synthesis. Adenosylcobalamin is a coenzyme required for the activity of methylmalonyl-CoA mutase. Defects in this gene are a cause of methylmalonic aciduria. [provided by RefSeq, Jul 2008]
Research Articles on MMAA
Similar Products
Product Notes
The MMAA mmaa (Catalog #AAA3216258) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMAA antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MMAA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MMAA mmaa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQRACLAEAI TLVESTHSRK KELAQVLLQK VLLYHREQEQ SNKGKPLAFR. It is sometimes possible for the material contained within the vial of "MMAA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
