Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MMABSample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MMAB Polyclonal Antibody | anti-MMAB antibody

MMAB Antibody - middle region

Gene Names
MMAB; ATR; cob; cblB; CFAP23
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MMAB; Polyclonal Antibody; MMAB Antibody - middle region; anti-MMAB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALEL
Sequence Length
173
Applicable Applications for anti-MMAB antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MMAB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MMABSample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MMABSample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MMAB antibody
This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (AdoCbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. Alternatively spliced transcript variants have been found.
Product Categories/Family for anti-MMAB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19 kDa
NCBI Official Full Name
corrinoid adenosyltransferase
NCBI Official Synonym Full Names
metabolism of cobalamin associated B
NCBI Official Symbol
MMAB
NCBI Official Synonym Symbols
ATR; cob; cblB; CFAP23
NCBI Protein Information
corrinoid adenosyltransferase; cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
UniProt Protein Name
Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
UniProt Gene Name
MMAB
UniProt Entry Name
MMAB_HUMAN

NCBI Description

This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (AdoCbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. Alternatively spliced transcript variants have been found. [provided by RefSeq, Apr 2011]

Uniprot Description

MMAB: Defects in MMAB are the cause of methylmalonic aciduria type cblB (MMAB); also known as methylmalonic aciduria type B or vitamin B12-responsive methylmalonicaciduria of cblB complementation type. MMAB is a disorder of methylmalonate and cobalamin metabolism due to defective synthesis of adenosylcobalamin. Inheritance is autosomal recessive. Belongs to the Cob(I)alamin adenosyltransferase family.

Protein type: Motility/polarity/chemotaxis; EC 2.5.1.17; Transferase; Cofactor and Vitamin Metabolism - porphyrin and chlorophyll

Chromosomal Location of Human Ortholog: 12q24

Cellular Component: mitochondrial matrix

Molecular Function: cob(I)yrinic acid a,c-diamide adenosyltransferase activity; ATP binding

Biological Process: vitamin metabolic process; cobalamin biosynthetic process; cobalamin metabolic process; water-soluble vitamin metabolic process

Disease: Methylmalonic Aciduria, Cblb Type

Research Articles on MMAB

Similar Products

Product Notes

The MMAB mmab (Catalog #AAA3221108) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMAB Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MMAB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MMAB mmab for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PRIPKIYTKT GDKGFSSTFT GERRPKDDQV FEAVGTTDEL SSAIGFALEL. It is sometimes possible for the material contained within the vial of "MMAB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.