<
Western Blot (WB)
(Host: RabbitTarget Name: MLLT3Sample Type: 721_BAntibody Dilution: 1.0ug/mlMLLT3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Rabbit MLLT3 Polyclonal Antibody | anti-MLLT3 antibody
MLLT3 antibody - C-terminal region
Gene Names
MLLT3; AF9; YEATS3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MLLT3; Polyclonal Antibody; MLLT3 antibody - C-terminal region; anti-MLLT3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS
Sequence Length
342
Applicable Applications for anti-MLLT3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MLLT3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MLLT3Sample Type: 721_BAntibody Dilution: 1.0ug/mlMLLT3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Western Blot (WB)
(Host: RabbitTarget Name: MLLT3Sample Type: 721_BAntibody Dilution: 1.0ug/mlMLLT3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Western Blot (WB)
(Host: RabbitTarget Name: MLLT3Sample Type: HelaAntibody Dilution: 1.0ug/mlMLLT3 is supported by BioGPS gene expression data to be expressed in HeLa)
Western Blot (WB)
(Host: RabbitTarget Name: MLLT3Sample Type: HelaAntibody Dilution: 1.0ug/mlMLLT3 is supported by BioGPS gene expression data to be expressed in HeLa)
Western Blot (WB)
(Host: RabbitTarget Name: MLLT3Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MLLT3Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-MLLT3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-MLLT3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-MLLT3 antibody
This is a rabbit polyclonal antibody against MLLT3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: MLLT3 is a regulator of early erythroid and megakaryocytic cell fate in the human system. Expression of MLLT3 in human CD34+ cells induces acute myeloid, lymphoid, or mixed-lineage leukemia in immunodeficient mice. Translocation t (9;11)(p22;q23), a chromosomal aberration involving MLLT3 is associated with acute leukemias.
Target Description: MLLT3 is a regulator of early erythroid and megakaryocytic cell fate in the human system. Expression of MLLT3 in human CD34+ cells induces acute myeloid, lymphoid, or mixed-lineage leukemia in immunodeficient mice. Translocation t (9;11)(p22;q23), a chromosomal aberration involving MLLT3 is associated with acute leukemias.
Product Categories/Family for anti-MLLT3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37kDa
NCBI Official Full Name
LTG9/MLLT3 protein, partial
NCBI Official Synonym Full Names
MLLT3 super elongation complex subunit
NCBI Official Symbol
MLLT3
NCBI Official Synonym Symbols
AF9; YEATS3
NCBI Protein Information
protein AF-9
Protein Family
Research Articles on MLLT3
Similar Products
Product Notes
The MLLT3 (Catalog #AAA3204107) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MLLT3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MLLT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MLLT3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERHILQQIVN LIEETGHFHI TNTTFDFDLC SLDKTTVRKL QSYLETSGTS. It is sometimes possible for the material contained within the vial of "MLLT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
