Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IRF4Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Rabbit IRF4 Polyclonal Antibody | anti-IRF4 antibody

IRF4 antibody - middle region

Gene Names
IRF4; MUM1; LSIRF; SHEP8; NF-EM5
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IRF4; Polyclonal Antibody; IRF4 antibody - middle region; anti-IRF4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
Sequence Length
451
Applicable Applications for anti-IRF4 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IRF4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IRF4Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IRF4Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-IRF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateIRF4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-IRF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateIRF4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-IRF4 antibody
This is a rabbit polyclonal antibody against IRF4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IRF4 is a transcriptional activator. It binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter.It also binds the immunoglobulin lambda light chain enhancer, together with PU.1. IRF4 probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
interferon regulatory factor 4 isoform 1
NCBI Official Synonym Full Names
interferon regulatory factor 4
NCBI Official Symbol
IRF4
NCBI Official Synonym Symbols
MUM1; LSIRF; SHEP8; NF-EM5
NCBI Protein Information
interferon regulatory factor 4
UniProt Protein Name
Interferon regulatory factor 4
UniProt Gene Name
IRF4
UniProt Synonym Gene Names
MUM1; IRF-4; LSIRF
UniProt Entry Name
IRF4_HUMAN

NCBI Description

The protein encoded by this gene belongs to the IRF (interferon regulatory factor) family of transcription factors, characterized by an unique tryptophan pentad repeat DNA-binding domain. The IRFs are important in the regulation of interferons in response to infection by virus, and in the regulation of interferon-inducible genes. This family member is lymphocyte specific and negatively regulates Toll-like-receptor (TLR) signaling that is central to the activation of innate and adaptive immune systems. A chromosomal translocation involving this gene and the IgH locus, t(6;14)(p25;q32), may be a cause of multiple myeloma. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2010]

Uniprot Description

IRF4: Transcriptional activator. Binds to the interferon- stimulated response element (ISRE) of the MHC class I promoter. Binds the immunoglobulin lambda light chain enhancer, together with PU.1. Probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells. Interacts with SPIB and DEF6. Not induced by interferons. Lymphoid cells. Belongs to the IRF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding; Oncoprotein

Chromosomal Location of Human Ortholog: 6p25-p23

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; sequence-specific DNA binding; protein-lysine N-methyltransferase activity; transcription factor binding; transcription factor activity

Biological Process: T cell activation; transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; positive regulation of interleukin-2 biosynthetic process; positive regulation of transcription, DNA-dependent; regulation of T-helper cell differentiation; myeloid dendritic cell differentiation; defense response to protozoan; peptidyl-lysine methylation; positive regulation of interleukin-4 biosynthetic process; positive regulation of interleukin-10 biosynthetic process; positive regulation of interleukin-13 biosynthetic process; negative regulation of toll-like receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; positive regulation of DNA binding

Disease: Skin/hair/eye Pigmentation, Variation In, 8

Research Articles on IRF4

Similar Products

Product Notes

The IRF4 irf4 (Catalog #AAA3203932) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IRF4 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IRF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IRF4 irf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAHVEPLLAR QLYYFAQQNS GHFLRGYDLP EHISNPEDYH RSIRHSSIQE. It is sometimes possible for the material contained within the vial of "IRF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.