Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MLLT4 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateMLLT4 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit AFDN Polyclonal Antibody | anti-AFDN antibody

AFDN Antibody - N-terminal region

Gene Names
AFDN; AF6; MLLT4; MLL-AF6; l-afadin
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
AFDN; Polyclonal Antibody; AFDN Antibody - N-terminal region; anti-AFDN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAE
Sequence Length
674
Applicable Applications for anti-AFDN antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 85%; Rat: 100%; Yeast: 92%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MLLT4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MLLT4 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateMLLT4 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Western Blot (WB) (WB Suggested Anti-MLLT4 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateMLLT4 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Related Product Information for anti-AFDN antibody
This is a rabbit polyclonal antibody against MLLT4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a multi-domain protein involved in signaling and organization of cell junctions during embryogenesis. It has also been identified as the fusion partner of acute lymphoblastic leukemia (ALL-1) gene, involved in acute myeloid leukemias with t(6;11)(q27;q23) translocation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, however, not all have been fully characterized.
Product Categories/Family for anti-AFDN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4, isoform CRA_a
NCBI Official Synonym Full Names
afadin, adherens junction formation factor
NCBI Official Symbol
AFDN
NCBI Official Synonym Symbols
AF6; MLLT4; MLL-AF6; l-afadin
NCBI Protein Information
afadin
UniProt Protein Name
Afadin
Protein Family
UniProt Gene Name
MLLT4
UniProt Synonym Gene Names
AF6; Protein AF-6
UniProt Entry Name
AFAD_HUMAN

NCBI Description

This gene encodes a multi-domain protein involved in signaling and organization of cell junctions during embryogenesis. It has also been identified as the fusion partner of acute lymphoblastic leukemia (ALL-1) gene, involved in acute myeloid leukemias with t(6;11)(q27;q23) translocation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, however, not all have been fully characterized.[provided by RefSeq, May 2011]

Uniprot Description

Afadin: plays a role in adhesion by participating, along with E-cadherin and catenin, in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). Essential for the association of nectin and E-cadherin. Contains 1 forkhead-associated (FHA) domain, a phosphopeptide recognition domain; 1 dilute (DIL) domain, a myosin-like domain which may play a functional role in cellular processes or vectorial vesicle transport; 1 PDZ domain, which frequently binds the carboxyl-terminal sequences of proteins or phosphatidylinositol 4,5-bisphosphate in the plasma membrane; and 2 RA domains, which are associated with RasGTP effector activity. Five alternatively spliced isoforms have been described. Isoform 2 does not interact with F-actin.

Protein type: Oncoprotein; Motility/polarity/chemotaxis; Cell adhesion

Chromosomal Location of Human Ortholog: 6q27

Cellular Component: nucleoplasm; cell-cell adherens junction; apical part of cell; cytoplasm; plasma membrane; intercellular junction; cytosol; cell junction

Molecular Function: protein C-terminus binding; protein binding; Ras GTPase binding; cell adhesion molecule binding

Biological Process: intercellular junction assembly and maintenance; cell-cell signaling; cell adhesion; signal transduction

Research Articles on AFDN

Similar Products

Product Notes

The AFDN mllt4 (Catalog #AAA3201940) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AFDN Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AFDN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AFDN mllt4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVIQNFKRTL SKKEKKEKKK REKEALRQAS DKDDRPFQGE DVENSRLAAE. It is sometimes possible for the material contained within the vial of "AFDN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.