Western Blot (WB)
(WB Suggested Anti-MLLT1 Antibody Titration: 1.4ug/mlPositive Control: Raji cell lysateMLLT1 is supported by BioGPS gene expression data to be expressed in Raji)
Rabbit MLLT1 Polyclonal Antibody | anti-MLLT1 antibody
MLLT1 antibody - middle region
Gene Names
MLLT1; ENL; LTG19; YEATS1
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
MLLT1; Polyclonal Antibody; MLLT1 antibody - middle region; anti-MLLT1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMV
Sequence Length
559
Applicable Applications for anti-MLLT1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MLLT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MLLT1 Antibody Titration: 1.4ug/mlPositive Control: Raji cell lysateMLLT1 is supported by BioGPS gene expression data to be expressed in Raji)
Western Blot (WB)
(WB Suggested Anti-MLLT1 Antibody Titration: 1.4ug/mlPositive Control: Raji cell lysateMLLT1 is supported by BioGPS gene expression data to be expressed in Raji)
Related Product Information for anti-MLLT1 antibody
This is a rabbit polyclonal antibody against MLLT1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: MLLT1 is a homolog of the yeast SWI/SNF subunit, ANC1/TFG3. Moreover, MLLT0 is a fusion partner for the gene product of MLL that is a common target for chromosomal translocations in human acute leukemia
Target Description: MLLT1 is a homolog of the yeast SWI/SNF subunit, ANC1/TFG3. Moreover, MLLT0 is a fusion partner for the gene product of MLL that is a common target for chromosomal translocations in human acute leukemia
Product Categories/Family for anti-MLLT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
protein ENL
NCBI Official Synonym Full Names
MLLT1 super elongation complex subunit
NCBI Official Symbol
MLLT1
NCBI Official Synonym Symbols
ENL; LTG19; YEATS1
NCBI Protein Information
protein ENL
UniProt Protein Name
Protein ENL
Protein Family
UniProt Gene Name
MLLT1
UniProt Synonym Gene Names
ENL; LTG19; YEATS1
UniProt Entry Name
ENL_HUMAN
Uniprot Description
MLLT1: a transcriptional regulator that can activate transcription from synthetic reporter genes in both lymphoid and myeloid cells. A chromosomal aberration involving MLLT1 is associated with acute leukemias.
Protein type: Oncoprotein; Transcription regulation
Chromosomal Location of Human Ortholog: 19p13.3
Cellular Component: nucleoplasm; transcription elongation factor complex; cytoplasm; nucleolus; nucleus
Molecular Function: protein binding; DNA binding
Biological Process: transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; negative regulation of protein kinase activity
Research Articles on MLLT1
Similar Products
Product Notes
The MLLT1 mllt1 (Catalog #AAA3201109) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MLLT1 antibody - middle region reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MLLT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MLLT1 mllt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EESNSEDEAS FKSESAQSSP SNSSSSSDSS SDSDFEPSQN HSQGPLRSMV. It is sometimes possible for the material contained within the vial of "MLLT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
