Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MFNG Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit MFNG Polyclonal Antibody | anti-MFNG antibody

MFNG antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MFNG; Polyclonal Antibody; MFNG antibody - middle region; anti-MFNG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL
Sequence Length
321
Applicable Applications for anti-MFNG antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MFNG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MFNG Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-MFNG Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-MFNG antibody
This is a rabbit polyclonal antibody against MFNG. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-MFNG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
beta-1,3-N-acetylglucosaminyltransferase manic fringe isoform 1
NCBI Official Synonym Full Names
MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
NCBI Official Symbol
MFNG
NCBI Protein Information
beta-1,3-N-acetylglucosaminyltransferase manic fringe
UniProt Protein Name
Beta-1,3-N-acetylglucosaminyltransferase manic fringe
UniProt Gene Name
MFNG
UniProt Entry Name
MFNG_HUMAN

NCBI Description

This gene is a member of the glycosyltransferase 31 gene family. Members of this gene family, which also includes the LFNG (GeneID: 3955) and RFNG (GeneID: 5986) genes, encode evolutionarily conserved glycosyltransferases that act in the Notch signaling pathway to define boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, these proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. The protein encoded by this gene may control Notch signaling in claudin-low breast cancer. [provided by RefSeq, May 2018]

Uniprot Description

MFNG: Glycosyltransferase involved in the elongation of O- linked ligands to activate Notch signaling. Possesses fucose- specific beta-1,3-N-acetylglucosaminyltransferase activity. Belongs to the glycosyltransferase 31 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; Membrane protein, integral; EC 2.4.1.222

Chromosomal Location of Human Ortholog: 22q12

Cellular Component: extracellular space; integral to Golgi membrane

Molecular Function: metal ion binding; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity

Biological Process: positive regulation of protein binding; metabolic process; pattern specification process; positive regulation of Notch signaling pathway

Research Articles on MFNG

Similar Products

Product Notes

The MFNG mfng (Catalog #AAA3209078) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MFNG antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MFNG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MFNG mfng for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAPWASGSRF MDTSALIRLP DDCTMGYIIE CKLGGRLQPS PLFHSHLETL. It is sometimes possible for the material contained within the vial of "MFNG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.