Mouse anti-Human MFNG Monoclonal Antibody | anti-MFNG antibody

MFNG (Beta-1,3-N-acetylglucosaminyltransferase Manic Fringe, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) APC

Cat. Num. AAA6137600

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MFNG; Monoclonal Antibody; MFNG (Beta-1; 3-N-acetylglucosaminyltransferase Manic Fringe; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) APC; anti-MFNG antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B11
• Specificity: Recognizes human MFNG.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-MFNG antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa214-291 from human MFNG (NP_002396) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: WASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGP
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.32kD).)

Testing Data

(Detection limit for recombinant GST tagged MFNG is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-MFNG antibody

MFNG is a 52-55kD member of the glucosyltransferase 31 family. It is a Golgi membrane protein that transfers N-acetylglucosamine to an O-linked fucose residue on Notch. Activity on Notch increases Delta-1 induced signaling while suppressing Jagged-1 signaling. MFNG is found in fetal pancreatic endocrine progenitor cells and immature ventricular zone neurons. Human MFNG is a 321aa type II transmembrane protein. It contains a short 7aa cytoplasmic region, plus a 294aa luminal domain (aa28-321). There are two potential splice variants, one that shows a 15aa substitution for aa104-321, and another that contains a three aa substitution for aa86-102. Over aa37-321, human MFNG shares 85% aa identity with mouse MFNG.

Product Categories/Family for anti-MFNG antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 21536461
• NCBI GeneID: 4242
• NCBI Accession #: NP_002396
• NCBI GenBank Nucleotide #: NM_002405
• UniProt Accession #: O00587
• Molecular Weight: 36kDa
• NCBI Official Full Name: beta-1,3-N-acetylglucosaminyltransferase manic fringe isoform 1
• NCBI Official Synonym Full Names: MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
• NCBI Official Symbol: MFNG
• NCBI Protein Information: beta-1,3-N-acetylglucosaminyltransferase manic fringe
• UniProt Protein Name: Beta-1,3-N-acetylglucosaminyltransferase manic fringe
• Protein Family: Beta-1,3-N-acetylglucosaminyltransferase manic fringe
• UniProt Gene Name: MFNG
• UniProt Entry Name: MFNG_HUMAN

NCBI Description

This gene is a member of the glycosyltransferase 31 gene family. Members of this gene family, which also includes the LFNG (GeneID: 3955) and RFNG (GeneID: 5986) genes, encode evolutionarily conserved glycosyltransferases that act in the Notch signaling pathway to define boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, these proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. The protein encoded by this gene may control Notch signaling in claudin-low breast cancer. [provided by RefSeq, May 2018]

Uniprot Description

MFNG: Glycosyltransferase involved in the elongation of O- linked ligands to activate Notch signaling. Possesses fucose- specific beta-1,3-N-acetylglucosaminyltransferase activity. Belongs to the glycosyltransferase 31 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; Membrane protein, integral; EC 2.4.1.222

Chromosomal Location of Human Ortholog: 22q12

Cellular Component: extracellular space; integral to Golgi membrane

Molecular Function: metal ion binding; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity

Biological Process: positive regulation of protein binding; metabolic process; pattern specification process; positive regulation of Notch signaling pathway