Mouse anti-Human MFAP-2 Polyclonal Antibody | anti-MFAP2 antibody

MFAP-2 (Microfibrillar-associated Protein 2, Microfibril-associated Glycoprotein 1, MAGP, MAGP-1, MAGP1, MFAP2)

Cat. Num. AAA6005197

• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: MFAP-2; Polyclonal Antibody; MFAP-2 (Microfibrillar-associated Protein 2; Microfibril-associated Glycoprotein 1; MAGP; MAGP-1; MAGP1; MFAP2); Anti -MFAP-2 (Microfibrillar-associated Protein 2; anti-MFAP2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MFAP2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC

• Applicable Applications for anti-MFAP2 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human MFAP2, aa1-183 (NP_002394.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MFAP2 polyclonal antibody. Western Blot analysis of MFAP2 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of MFAP2 expression in transfected 293T cell line by MFAP2 polyclonal antibody. Lane 1: MFAP2 transfected lysate (20.13KD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-MFAP2 antibody

Along with elastin, elaunin, oxytalan, and elastin-associated proteins fibrillin-1, microfibrillar-associated glycoprotein-1 (MAGP or MFAP-2) can be found within the juxtacanalicular tissue of the inner and outer walls and within the collector channel walls of human eyes perfused at low and high pressure, among other certain human tissues. MAGP-1 (MFAP-2) is shown to play a significant role in the support and distensibility of the juxtacanalicular region of these collector channels. It is also reported to inhibit LTB-1 binding to fibrillin-1, stimulate the phosphorylation of Smad2, and thereby mediate the subsequent extracellular deposition of latent TGFbeta.

Product Categories/Family for anti-MFAP2 antibody

Antibodies; Abs to Extracellular Matrix Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 27805997
• NCBI GeneID: 281912
• NCBI Accession #: NP_776813.1
• NCBI GenBank Nucleotide #: NM_174388.2
• UniProt Accession #: P27424
• Molecular Weight: 20,709 Da
• NCBI Official Full Name: microfibrillar-associated protein 2
• NCBI Official Synonym Full Names: microfibrillar-associated protein 2<
• NCBI Official Symbol: MFAP2
• NCBI Protein Information: microfibrillar-associated protein 2; MAGP; MAGP-1; MFAP-2; tropoelastin-binding protein; microfibril-associated glycoprotein 1
• UniProt Protein Name: Microfibrillar-associated protein 2
• Protein Family: Microfibrillar-associated protein
• UniProt Gene Name: MFAP2
• UniProt Synonym Gene Names: MAGP; MAGP1; MFAP-2; MAGP; MAGP-1
• UniProt Entry Name: MFAP2_BOVIN

Uniprot Description

Function: Component of the elastin-associated microfibrils.

Subunit structure: Forms a ternary complex with BGN and ELN.

Subcellular location: Secreted › extracellular space › extracellular matrix.

Post-translational modification: O-glycosylated; glycans consist of Gal(beta1-3)GalNAc. Ref.3 Ref.5Forms intermolecular disulfide bonds either with other MAGP-1 molecules or with other components of the microfibrils.Forms transglutaminase cross-links with tropoelastin.

Sequence similarities: Belongs to the MFAP family.Contains 1 ShKT domain.