Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SGCG rabbit polyclonal antibody. Western Blot analysis of SGCG expression in human kidney.)

Rabbit anti-Human SGCG Polyclonal Antibody | anti-sgcg antibody

SGCG (Gamma-sarcoglycan, Gamma-SG, 35 kDa Dystrophin-associated Glycoprotein, 35DAG)

Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
SGCG; Polyclonal Antibody; SGCG (Gamma-sarcoglycan; Gamma-SG; 35 kDa Dystrophin-associated Glycoprotein; 35DAG); Anti -SGCG (Gamma-sarcoglycan; anti-sgcg antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SGCG.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHICL
Applicable Applications for anti-sgcg antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human SGCG, aa1-291 (NP_000222.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SGCG rabbit polyclonal antibody. Western Blot analysis of SGCG expression in human kidney.)

Western Blot (WB) (SGCG rabbit polyclonal antibody. Western Blot analysis of SGCG expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of SGCG expression in transfected 293T cell line by SGCG polyclonal antibody. Lane 1: SGCG transfected lysate (32.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SGCG expression in transfected 293T cell line by SGCG polyclonal antibody. Lane 1: SGCG transfected lysate (32.4kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of SGCG transfected lysate using SGCG rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with SGCG mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SGCG transfected lysate using SGCG rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with SGCG mouse polyclonal antibody.)
Related Product Information for anti-sgcg antibody
This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).
Product Categories/Family for anti-sgcg antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
sgcg protein
NCBI Official Synonym Full Names
sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
NCBI Official Symbol
sgcg
NCBI Protein Information
sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein); sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein); gamma sarcoglycan
Protein Family

Similar Products

Product Notes

The sgcg (Catalog #AAA6008178) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SGCG (Gamma-sarcoglycan, Gamma-SG, 35 kDa Dystrophin-associated Glycoprotein, 35DAG) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SGCG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the sgcg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVREQYTTAT EGICIERPEN QYVYKIGIYG WRKRCLYLFV LLLLIILVVN LALTIWILKV MWFSPAGMGH LCVTKDGLRL EGESEFLFPL YAKEIHSRVD SSLLLQSTQN VTVNARNSEG EVTGRLKVGP KMVEVQNQQF QINSNDGKPL FTVDEKEVVV GTDKLRVTGP EGALFEHSVE TPLVRADPFQ DLRLESPTRS LSMDAPRGVH IQAHAGKIEA LSQMDILFHS SDGMLVLDAE TVCLPKLVQG TWGPSGSSQS LYEICVCPDG KLYLSVAGVS TTCQEHSHIC L. It is sometimes possible for the material contained within the vial of "SGCG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.