MEK3 Polyclonal Antibody | anti-MEK3 antibody

Anti-MEK3 Antibody

Cat. Num. AAA177922

• Gene Names: MAP2K3; MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: MEK3; Polyclonal Antibody; Anti-MEK3 Antibody; Dual specificity mitogen-activated protein kinase kinase 3(MAP kinase kinase 3/MAPKK 3); AW212142; Dual specificity mitogen activated protein kinase kinase 3; Dual specificity mitogen-activated protein kinase kinase 3; ERK kinase 3; MAP kinase kinase 3; MAP2K 3; map2k3; MAPK ERK kinase 3; MAPK kinase 3; MAPK/ERK kinase 3; MAPKK 3; MAPKK3; MEK 3; Mitogen activated protein kinase kinase 3; MKK 3; MKK3; mMKK 3b; mMKK3b; MP2K3_HUMAN; MPK 3; PRKMK 3; PRKMK3; Protein kinase mitogen activated kinase 3; protein kinase; mitogen-activated; kinase 3; SAPK kinase 2; SAPKK 2; SAPKK2; SKK2; Stress activated protein kinase kinase 2; zMKK 3; mitogen-activated protein kinase kinase 3; anti-MEK3 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 318

• Applicable Applications for anti-MEK3 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311-347aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS), identical to the related mouse sequence.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- MEK3 Picoband antibody, MBS177922, Western blottingAll lanes: Anti MEK3 (MBS177922) at 0.5ug/mlLane 1: Mouse Spleen Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 40KDObserved bind size: 40KD)

Immunohistochemistry (IHC)

(Anti- MEK3 Picoband antibody, MBS177922, IHC(P)IHC(P): Mouse Skeletal Muscle Tissue )

Immunohistochemistry (IHC)

(Anti- MEK3 Picoband antibody, MBS177922, IHC(P)IHC(P): Rat Skeletal Muscle Tissue )

Immunohistochemistry (IHC)

(Anti- MEK3 Picoband antibody, MBS177922, IHC(P)IHC(P): Human Intestinal Cancer Tissue )

Related Product Information for anti-MEK3 antibody

Description: Rabbit IgG polyclonal antibody for Dual specificity mitogen-activated protein kinase kinase 3(MAP kinase kinase 3/MAPKK 3)(MAP2K3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Dual specificity mitogen-activated protein kinase kinase 3 is an enzyme that in humans is encoded by the MAP2K3 gene. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. And this kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. Rampoldi et al. (1997) localized the MAP2K3 gene to 17q11.2.

References

1. Rampoldi L, Zimbello R, Bortoluzzi S, Tiso N, Valle G, Lanfranchi G, Danieli GA (Mar 1998). "Chromosomal localization of four MAPK signaling cascade genes: MEK1, MEK3, MEK4 and MEKK5". Cytogenet Cell Genet 78 (3-4): 301-3.

NCBI and Uniprot Product Information

• NCBI GI #: 938403439
• NCBI GeneID: 5606
• NCBI Accession #: NP_001303261.1
• NCBI GenBank Nucleotide #: NM_001316332.1
• UniProt Accession #: P46734; Q99441; Q9UE71; Q9UE72; B3KSK7
• Molecular Weight: 39,940 Da
• NCBI Official Full Name: dual specificity mitogen-activated protein kinase kinase 3 isoform A
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase 3
• NCBI Official Symbol: MAP2K3
• NCBI Official Synonym Symbols: MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2
• NCBI Protein Information: dual specificity mitogen-activated protein kinase kinase 3
• UniProt Protein Name: Dual specificity mitogen-activated protein kinase kinase 3
• UniProt Gene Name: MAP2K3
• UniProt Synonym Gene Names: MEK3; MKK3; PRKMK3; SKK2; MAP kinase kinase 3; MAPKK 3; MEK 3; SAPK kinase 2; SAPKK-2; SAPKK2
• UniProt Entry Name: MP2K3_HUMAN

NCBI Description

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

MKK3: a dual-specificity protein kinase of the STE7 family. Activates p38 MAP kinase by phosphorylating a Thr and a Tyr residue in the activation loop. Is activated by cytokines and environmental stress in vivo. A deletion and two point mutants found in colon cancer cell lines. Three splice-variant isoforms have been described.

Protein type: EC 2.7.12.2; Kinase, protein; Protein kinase, dual-specificity (non-receptor); Protein kinase, STE; STE group; STE7 family

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: cytoplasm; cytosol; membrane; nucleoplasm

Molecular Function: ATP binding; MAP kinase kinase activity; protein binding; protein kinase binding; protein-tyrosine kinase activity; receptor signaling protein serine/threonine kinase activity

Biological Process: activation of MAPK activity; cardiac muscle contraction; inflammatory response; MAPKKK cascade; peptidyl-tyrosine phosphorylation; positive regulation of protein kinase activity; positive regulation of transcription, DNA-dependent; regulation of cytokine biosynthetic process; signal transduction