Dual specificity mitogen-activated protein kinase kinase 3 Recombinant Protein | MAP2K3 recombinant protein

Recombinant Human Dual specificity mitogen-activated protein kinase kinase 3

Cat. Num. AAA952800

• Gene Names: MAP2K3; MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Dual specificity mitogen-activated protein kinase kinase 3; Recombinant Human Dual specificity mitogen-activated protein kinase kinase 3; MAPK/ERK kinase 3; MEK 3; Stress-activated protein kinase kinase 2; SAPK kinase 2; SAPKK-2; SAPKK2; MAP2K3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-347aa; Full Length
• Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
• Sequence Length: 352

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for MAP2K3 recombinant protein

Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38.

Product Categories/Family for MAP2K3 recombinant protein

Cancer

References

Independent human MAP-kinase signal transduction pathways defined by MEK and MKK isoforms.Derijard B., Raingeaud J., Barrett T., Wu I.-H., Han J., Ulevitch R.J., Davis R.J.Science 267:682-685(1995) Purification and identification of a major activator for p38 from osmotically shocked cells activation of mitogen-activated protein kinase kinase 6 by osmotic shock, tumor necrosis factor-alpha, and H2O2.Moriguchi T., Toyoshima F., Gotoh Y., Iwamatsu A., Irie K., Mori E., Kuroyanagi N., Hagiwara M., Matsumoto K., Nishida E.J. Biol. Chem. 271:26981-26988(1996) Han J.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) MKK3- and MKK6-regulated gene expression is mediated by the p38 mitogen-activated protein kinase signal transduction pathway.Raingeaud J., Whitmarsh A.J., Barrett T., Derijard B., Davis R.J.Mol. Cell. Biol. 16:1247-1255(1996) Regulation of stress-responsive mitogen-activated protein (MAP) kinase pathways by TAO2.Chen Z., Cobb M.H.J. Biol. Chem. 276:16070-16075(2001) Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha.Lim S., Jin K., Friedman E.J. Biol. Chem. 277:25040-25046(2002) Platelet-activating factor-induced clathrin-mediated endocytosis requires beta-arrestin-1 recruitment and activation of the p38 MAPK signalosome at the plasma membrane for actin bundle formation.McLaughlin N.J., Banerjee A., Kelher M.R., Gamboni-Robertson F., Hamiel C., Sheppard F.R., Moore E.E., Silliman C.C.J. Immunol. 176:7039-7050(2006) Yersinia YopJ acetylates and inhibits kinase activation by blocking phosphorylation.Mukherjee S., Keitany G., Li Y., Wang Y., Ball H.L., Goldsmith E.J., Orth K.Science 312:1211-1214(2006) Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.Anal. Chem. 81:4493-4501(2009) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) Mutation analyses of 268 candidate genes in human tumor cell lines.Teng D.-H., Chen Y., Lian L., Ha P.C., Tavtigian S.V., Wong A.K.C.Genomics 74:352-364(2001) Patterns of somatic mutation in human cancer genomes.Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G., Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.Nature 446:153-158(2007)

NCBI and Uniprot Product Information

• NCBI GI #: 938403439
• NCBI GeneID: 5606
• NCBI Accession #: NP_001303261.1
• NCBI GenBank Nucleotide #: NM_001316332.1
• UniProt Accession #: P46734; Q99441; Q9UE71; Q9UE72; B3KSK7
• Molecular Weight: 55.3 kDa
• NCBI Official Full Name: dual specificity mitogen-activated protein kinase kinase 3 isoform A
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase 3
• NCBI Official Symbol: MAP2K3
• NCBI Official Synonym Symbols: MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2
• NCBI Protein Information: dual specificity mitogen-activated protein kinase kinase 3
• UniProt Protein Name: Dual specificity mitogen-activated protein kinase kinase 3
• Protein Family: Dual specificity mitogen-activated protein kinase kinase
• UniProt Gene Name: MAP2K3
• UniProt Synonym Gene Names: MEK3; MKK3; PRKMK3; SKK2; MAP kinase kinase 3; MAPKK 3; MEK 3; SAPK kinase 2; SAPKK-2; SAPKK2
• UniProt Entry Name: MP2K3_HUMAN

NCBI Description

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

MKK3: a dual-specificity protein kinase of the STE7 family. Activates p38 MAP kinase by phosphorylating a Thr and a Tyr residue in the activation loop. Is activated by cytokines and environmental stress in vivo. A deletion and two point mutants found in colon cancer cell lines. Three splice-variant isoforms have been described.

Protein type: EC 2.7.12.2; Protein kinase, dual-specificity (non-receptor); Protein kinase, STE; Kinase, protein; STE group; STE7 family

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: cytoplasm; cytosol; membrane; nucleoplasm

Molecular Function: ATP binding; MAP kinase kinase activity; protein binding; protein kinase binding; protein serine/threonine kinase activity; protein-tyrosine kinase activity

Biological Process: activation of MAPK activity; cardiac muscle contraction; inflammatory response; innate immune response; MyD88-dependent toll-like receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; peptidyl-tyrosine phosphorylation; positive regulation of protein kinase activity; positive regulation of transcription, DNA-dependent; regulation of apoptosis; regulation of cytokine biosynthetic process; regulation of mitotic cell cycle; signal transduction; stress-activated MAPK cascade; stress-activated protein kinase signaling pathway; toll-like receptor 10 signaling pathway; toll-like receptor 2 signaling pathway; toll-like receptor 3 signaling pathway; toll-like receptor 4 signaling pathway; toll-like receptor 5 signaling pathway; toll-like receptor 9 signaling pathway; toll-like receptor signaling pathway