Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MECR AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Rabbit MECR Polyclonal Antibody | anti-MECR antibody

MECR antibody - C-terminal region

Gene Names
MECR; ETR1; NRBF1; CGI-63; FASN2B; DYTOABG
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MECR; Polyclonal Antibody; MECR antibody - C-terminal region; anti-MECR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQP
Sequence Length
297
Applicable Applications for anti-MECR antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MECR AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Western Blot (WB) (WB Suggested Anti-MECR AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)
Related Product Information for anti-MECR antibody
This is a rabbit polyclonal antibody against MECR. It was validated on Western Blot

Target Description: MECR catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. It may have a role in the mitochondrial synthesis of fatty acids.
Product Categories/Family for anti-MECR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
enoyl-[acyl-carrier-protein] reductase, mitochondrial isoform b
NCBI Official Synonym Full Names
mitochondrial trans-2-enoyl-CoA reductase
NCBI Official Symbol
MECR
NCBI Official Synonym Symbols
ETR1; NRBF1; CGI-63; FASN2B; DYTOABG
NCBI Protein Information
enoyl-[acyl-carrier-protein] reductase, mitochondrial
UniProt Protein Name
Trans-2-enoyl-CoA reductase, mitochondrial
UniProt Gene Name
MECR
UniProt Synonym Gene Names
NBRF1; HsNrbf-1; NRBF-1
UniProt Entry Name
MECR_HUMAN

NCBI Description

The protein encoded by this gene is an oxidoreductase that catalyzes the last step in mitochondrial fatty acid synthesis. Defects in this gene are a cause of childhood-onset dystonia and optic atrophy. [provided by RefSeq, Mar 2017]

Uniprot Description

MECR: Catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. May have a role in the mitochondrial synthesis of fatty acids. Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - fatty acid elongation in mitochondria; Oxidoreductase; EC 1.3.1.38

Chromosomal Location of Human Ortholog: 1p35.3

Cellular Component: mitochondrion; nucleus

Molecular Function: zinc ion binding; trans-2-enoyl-CoA reductase (NADPH) activity

Biological Process: fatty acid metabolic process; fatty acid biosynthetic process

Research Articles on MECR

Similar Products

Product Notes

The MECR mecr (Catalog #AAA3215368) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MECR antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MECR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MECR mecr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRPEMKNFFK DMPQPRLALN CVGGKSSTEL LRQLARGGTM VTYGGMAKQP. It is sometimes possible for the material contained within the vial of "MECR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.