Western Blot (WB)
(WB Suggested Anti-TGIF2LY AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole Cell)
Rabbit anti-Human, Yeast TGIF2LY Polyclonal Antibody | anti-TGIF2LY antibody
TGIF2LY antibody - middle region
Gene Names
TGIF2LY; TGIFLY
Reactivity
Human, Yeast
Applications
Western Blot
Purity
Protein A purified
Synonyms
TGIF2LY; Polyclonal Antibody; TGIF2LY antibody - middle region; anti-TGIF2LY antibody
Host
Rabbit
Reactivity
Human, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGP
Sequence Length
185
Applicable Applications for anti-TGIF2LY antibody
Western Blot (WB)
Homology
Human: 100%; Yeast: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TGIF2LY
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TGIF2LY AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-TGIF2LY AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-TGIF2LY antibody
This is a rabbit polyclonal antibody against TGIF2LY. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TGIF2LY is a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX.This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX.
Target Description: TGIF2LY is a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX.This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX.
Product Categories/Family for anti-TGIF2LY antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
homeobox protein TGIF2LY
NCBI Official Synonym Full Names
TGFB induced factor homeobox 2 like Y-linked
NCBI Official Symbol
TGIF2LY
NCBI Official Synonym Symbols
TGIFLY
NCBI Protein Information
homeobox protein TGIF2LY
UniProt Protein Name
Homeobox protein TGIF2LY
Protein Family
UniProt Gene Name
TGIF2LY
UniProt Synonym Gene Names
TGIFLY
UniProt Entry Name
TF2LY_HUMAN
NCBI Description
This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX. [provided by RefSeq, Jul 2008]
Uniprot Description
TGIF2LY: May have a transcription role in testis. May act as a competitor/regulator of TGIF2LX. Belongs to the TALE/TGIF homeobox family.
Protein type: DNA-binding; Transcription factor
Chromosomal Location of Human Ortholog: Yp11.2
Cellular Component: nucleus
Molecular Function: DNA binding
Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent
Research Articles on TGIF2LY
Similar Products
Product Notes
The TGIF2LY tgif2ly (Catalog #AAA3202970) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGIF2LY antibody - middle region reacts with Human, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TGIF2LY can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TGIF2LY tgif2ly for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NWFINARRRI LPDMLQQRRN DPIIGHKTGK DAHATHLQST EASVPAKSGP. It is sometimes possible for the material contained within the vial of "TGIF2LY, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
