Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human PDHB Monoclonal Antibody | anti-PDHB antibody

PDHB (PHE1B, Pyruvate Dehydrogenase E1 Component Subunit beta, Mitochondrial, PDHE1-B, DKFZp564K0164) (HRP)

Gene Names
PDHB; PDHBD; PHE1B; PDHE1-B
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDHB; Monoclonal Antibody; PDHB (PHE1B; Pyruvate Dehydrogenase E1 Component Subunit beta; Mitochondrial; PDHE1-B; DKFZp564K0164) (HRP); anti-PDHB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B2
Specificity
Recognizes human PDHB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PDHB antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa250-360 from human PDHB (NP_000916) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(PDHB monoclonal antibody Western Blot analysis of PDHB expression in HeLa.)

Western Blot (WB) (PDHB monoclonal antibody Western Blot analysis of PDHB expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of PDHB expression in transfected 293T cell line by PDHB monoclonal antibody. Lane 1: PDHB transfected lysate (39.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PDHB expression in transfected 293T cell line by PDHB monoclonal antibody. Lane 1: PDHB transfected lysate (39.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PDHB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PDHB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PDHB is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PDHB is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-PDHB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,514 Da
NCBI Official Full Name
pyruvate dehydrogenase E1 component subunit beta, mitochondrial isoform 1
NCBI Official Synonym Full Names
pyruvate dehydrogenase (lipoamide) beta
NCBI Official Symbol
PDHB
NCBI Official Synonym Symbols
PDHBD; PHE1B; PDHE1-B
NCBI Protein Information
pyruvate dehydrogenase E1 component subunit beta, mitochondrial; pyruvate dehydrogenase, E1 beta polypeptide
UniProt Protein Name
Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
UniProt Gene Name
PDHB
UniProt Synonym Gene Names
PHE1B; PDHE1-B
UniProt Entry Name
ODPB_HUMAN

Uniprot Description

PDHB: the beta subunit of pyruvate dehydrogenase (PDH), a mitochondrial matrix enzyme that catalyzes the oxidative decarboxylation of pyruvate, producing acetyl-CoA and CO2. A key enzyme in controlling the balance between lipid and glucose oxidation depending on substrate availability. The pyruvate dehydrogenase (PDH) holoenzyme is a multi-enzyme complex (PDHC) that contains 20-30 copies of pyruvate decarboxylase tetramers (2 alpha:2 beta)(E1), 60 copies of dihydrolipoamide acetyltransferase (E2), six homodimers of dihydrolipoamide dehydrogenase (E3), plus E3 binding proteins. Defects in PDHB are a cause of pyruvate dehydrogenase E1 component deficiency (PDHE1 deficiency), the most common enzyme defect in patients with primary lactic acidosis. It is associated with variable clinical phenotypes ranging from neonatal death to prolonged survival complicated by developmental delay, seizures, ataxia, apnea, and in some cases to an X-linked form of Leigh syndrome (LS). Two alternatively spliced human isoforms have been described.

Protein type: Carbohydrate Metabolism - citrate (TCA) cycle; Amino Acid Metabolism - valine, leucine and isoleucine biosynthesis; EC 1.2.4.1; Carbohydrate Metabolism - pyruvate; Oxidoreductase; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Mitochondrial; Carbohydrate Metabolism - butanoate

Chromosomal Location of Human Ortholog: 3p21.1-p14.2

Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; pyruvate dehydrogenase complex; nucleus

Molecular Function: protein binding; pyruvate dehydrogenase activity; pyruvate dehydrogenase (acetyl-transferring) activity

Biological Process: cellular metabolic process; acetyl-CoA biosynthetic process from pyruvate; tricarboxylic acid cycle; glucose metabolic process; regulation of acetyl-CoA biosynthetic process from pyruvate; pyruvate metabolic process

Disease: Pyruvate Dehydrogenase E1-beta Deficiency

Similar Products

Product Notes

The PDHB pdhb (Catalog #AAA6154067) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDHB (PHE1B, Pyruvate Dehydrogenase E1 Component Subunit beta, Mitochondrial, PDHE1-B, DKFZp564K0164) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDHB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDHB pdhb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDHB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.