Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- LOXL2 Picoband antibody, MBS177930, Western blottingAll lanes: Anti LOXL2 (MBS177930) at 0.5ug/mlLane 1: Mouse Testis Tissue Lysate at 50ugLane 2: Rat Ovary Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: 22RV1 Whole Cell Lysate at 40ugLane 6: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 87KDObserved bind size: 87KD )

LOXL2 Polyclonal Antibody | anti-LOXL2 antibody

Anti-LOXL2 Antibody

Gene Names
LOXL2; LOR2; WS9-14
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
LOXL2; Polyclonal Antibody; Anti-LOXL2 Antibody; Lysyl oxidase homolog 2; LOR 2; LOR2; LOX L2; LOXL 2; LOXL2_HUMAN; Lysyl oxidase like 2; Lysyl oxidase like protein 2; Lysyl oxidase related 2; Lysyl oxidase related protein 2; Lysyl oxidase related protein WS9 14; Lysyl oxidase-like protein 2; Lysyl oxidase-related protein 2; Lysyl oxidase-related protein WS9-14; WS9 14; lysyl oxidase-like 2; anti-LOXL2 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
774
Applicable Applications for anti-LOXL2 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human LOXL2 (739-770aa HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ), different from the related mouse and rat sequences by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- LOXL2 Picoband antibody, MBS177930, Western blottingAll lanes: Anti LOXL2 (MBS177930) at 0.5ug/mlLane 1: Mouse Testis Tissue Lysate at 50ugLane 2: Rat Ovary Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: 22RV1 Whole Cell Lysate at 40ugLane 6: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 87KDObserved bind size: 87KD )

Western Blot (WB) (Anti- LOXL2 Picoband antibody, MBS177930, Western blottingAll lanes: Anti LOXL2 (MBS177930) at 0.5ug/mlLane 1: Mouse Testis Tissue Lysate at 50ugLane 2: Rat Ovary Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: 22RV1 Whole Cell Lysate at 40ugLane 6: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 87KDObserved bind size: 87KD )
Related Product Information for anti-LOXL2 antibody
Description: Rabbit IgG polyclonal antibody for Lysyl oxidase homolog 2(LOXL2) detection. Tested with WB in Human;Mouse;Rat.

Background: Lysyl oxidase homolog 2 is an enzyme that in humans is encoded by the LOXL2 gene. This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. LOXL2 can also crosslink collagen type IV and hence influence the sprouting of new blood vessels.
References
1. "Entrez Gene: LOXL2 lysyl oxidase-like 2". 2. Bignon M, Pichol-Thievend C, Hardouin J, Malbouyres M, Bréchot N, Nasciutti L, Barret A, Teillon J, Guillon E, Etienne E, Caron M, Joubert-Caron R, Monnot C, Ruggiero F, Muller L, Germain S (2011). "Lysyl oxidase-like protein-2 regulates sprouting angiogenesis and type IV collagen assembly in the endothelial basement membrane".Blood 118: 3979-89. 3. Jourdan-Le Saux C, Le Saux O, Donlon T, Boyd CD, Csiszar K (Jul 1998). "The human lysyl oxidase-related gene (LOXL2) maps between markers D8S280 and D8S278 on chromosome 8p21.2-p21.3". Genomics 51 (2): 305-7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86,725 Da
NCBI Official Full Name
lysyl oxidase homolog 2
NCBI Official Synonym Full Names
lysyl oxidase like 2
NCBI Official Symbol
LOXL2
NCBI Official Synonym Symbols
LOR2; WS9-14
NCBI Protein Information
lysyl oxidase homolog 2
UniProt Protein Name
Lysyl oxidase homolog 2
Protein Family
UniProt Gene Name
LOXL2
UniProt Entry Name
LOXL2_HUMAN

NCBI Description

This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq, Jul 2008]

Uniprot Description

LOXL2: Mediates the post-translational oxidative deamination of lysine residues on target proteins leading to the formation of deaminated lysine (allysine). When secreted in extracellular matrix, promotes cross-linking of extracellular matrix proteins by mediating oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Acts as a regulator of sprouting angiogenesis, probably via collagen IV scaffolding. When nuclear, acts as a transcription corepressor and specifically mediates deamination of trimethylated 'Lys-4' of histone H3 (H3K4me3), a specific tag for epigenetic transcriptional activation. Involved in epithelial to mesenchymal transition (EMT) via interaction with SNAI1 and participates in repression of E- cadherin, probably by mediating deamination of histone H3. Also involved in E-cadherin repression following hypoxia, a hallmark of epithelial to mesenchymal transition believed to amplify tumor aggressiveness, suggesting that it may play a role in tumor progression. Acts as a regulator of chondrocyte differentiation, probably by regulating expression of factors that control chondrocyte differentiation. Belongs to the lysyl oxidase family.

Protein type: EC 1.4.3.13; Cell adhesion; Secreted, signal peptide; Secreted; Oxidoreductase

Chromosomal Location of Human Ortholog: 8p21.3

Cellular Component: basement membrane; chromosome; extracellular space; membrane; nucleoplasm; nucleus

Molecular Function: chromatin binding; copper ion binding; electron carrier activity; methylated histone residue binding; protein binding; protein-lysine 6-oxidase activity; scavenger receptor activity; transcription corepressor activity

Biological Process: aging; cell adhesion; collagen fibril organization; endothelial cell migration; endothelial cell proliferation; epithelial to mesenchymal transition; histone modification; negative regulation of transcription, DNA-dependent; positive regulation of chondrocyte differentiation; protein amino acid deamination; protein modification process; receptor-mediated endocytosis; response to copper ion; response to hypoxia; sprouting angiogenesis; transcription, DNA-dependent

Research Articles on LOXL2

Similar Products

Product Notes

The LOXL2 loxl2 (Catalog #AAA177930) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-LOXL2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LOXL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the LOXL2 loxl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LOXL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.