Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LIG1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateLIG1 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit LIG1 Polyclonal Antibody | anti-LIG1 antibody

LIG1 Antibody - middle region

Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LIG1; Polyclonal Antibody; LIG1 Antibody - middle region; anti-LIG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR
Sequence Length
919
Applicable Applications for anti-LIG1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LIG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LIG1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateLIG1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-LIG1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateLIG1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-LIG1 antibody
This is a rabbit polyclonal antibody against LIG1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the ATP-dependent DNA ligase protein family. The encoded protein functions in DNA replication, recombination, and the base excision repair process. Mutations in this gene that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents. Disruption of this gene may also be associated with a variety of cancers. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102kDa
NCBI Official Full Name
DNA ligase 1 isoform 1
NCBI Official Synonym Full Names
DNA ligase 1
NCBI Official Symbol
LIG1
NCBI Protein Information
DNA ligase 1
UniProt Protein Name
DNA ligase 1
Protein Family
UniProt Gene Name
LIG1
UniProt Entry Name
DNLI1_HUMAN

NCBI Description

This gene encodes a member of the ATP-dependent DNA ligase protein family. The encoded protein functions in DNA replication, recombination, and the base excision repair process. Mutations in this gene that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents. Disruption of this gene may also be associated with a variety of cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

LIG1: is an enzyme that functions in DNA replication and the base excision repair process. Mutations leading to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents.

Protein type: Ligase; EC 6.5.1.1; DNA repair, damage

Chromosomal Location of Human Ortholog: 19q13.2-q13.3

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle; mitochondrion; chromosome; nucleus

Molecular Function: DNA binding; DNA ligase activity; metal ion binding; DNA ligase (ATP) activity; ATP binding

Biological Process: anatomical structure morphogenesis; mismatch repair; V(D)J recombination; DNA strand elongation during DNA replication; DNA repair; lagging strand elongation; double-strand break repair via homologous recombination; double-strand break repair via nonhomologous end joining; telomere maintenance via semi-conservative replication; response to hydrogen peroxide; base-excision repair; nucleotide-excision repair; cell division; transcription-coupled nucleotide-excision repair; double-strand break repair; telomere maintenance via recombination; DNA ligation during DNA repair; nucleotide-excision repair, DNA gap filling; mitotic cell cycle; telomere maintenance; DNA metabolic process

Research Articles on LIG1

Similar Products

Product Notes

The LIG1 lig1 (Catalog #AAA3211593) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIG1 Antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LIG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LIG1 lig1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALEGGEVKIF SRNQEDNTGK YPDIISRIPK IKLPSVTSFI LDTEAVAWDR. It is sometimes possible for the material contained within the vial of "LIG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.