Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)

Rabbit LASS3 Polyclonal Antibody | anti-CERS3 antibody

LASS3 antibody - N-terminal region

Gene Names
CERS3; ARCI9; LASS3
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LASS3; Polyclonal Antibody; LASS3 antibody - N-terminal region; anti-CERS3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
RVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLA
Applicable Applications for anti-CERS3 antibody
Western Blot (WB)
Protein Size (# AA)
383 amino acids
Blocking Peptide
For anti-CERS3 (MBS3200533) antibody is Catalog # MBS3225585.
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LASS3
Predicted Homology
Cow: 92%; Dog: 93%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 85%; Rabbit: 77%; Rat: 77%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)

Western Blot (WB) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)
Related Product Information for anti-CERS3 antibody
SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis.
Product Categories/Family for anti-CERS3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
ceramide synthase 3 isoform 2
NCBI Official Synonym Full Names
ceramide synthase 3
NCBI Official Symbol
CERS3
NCBI Official Synonym Symbols
ARCI9; LASS3
NCBI Protein Information
ceramide synthase 3
UniProt Protein Name
Ceramide synthase 3
Protein Family
UniProt Gene Name
CERS3
UniProt Synonym Gene Names
LASS3; CerS3
UniProt Entry Name
CERS3_HUMAN

NCBI Description

This gene is a member of the ceramide synthase family of genes. The ceramide synthase enzymes regulate sphingolipid synthesis by catalyzing the formation of ceramides from sphingoid base and acyl-coA substrates. This family member is involved in the synthesis of ceramides with ultra-long-chain acyl moieties (ULC-Cers), important to the epidermis in its role in creating a protective barrier from the environment. The protein encoded by this gene has also been implicated in modification of the lipid structures required for spermatogenesis. Mutations in this gene have been associated with male fertility defects, and epidermal defects, including ichthyosis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2015]

Uniprot Description

Function: May be involved in sphingolipid synthesis or its regulation

By similarity.

Subcellular location: Nucleus membrane; Multi-pass membrane protein

Potential.

Sequence similarities: Contains 1 homeobox DNA-binding domain.Contains 1 TLC (TRAM/LAG1/CLN8) domain.

Research Articles on CERS3

Similar Products

Product Notes

The CERS3 cers3 (Catalog #AAA3200533) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LASS3 antibody - N-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's LASS3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CERS3 cers3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RVFEKFVASP LAKSFGIKET VRKVTPNTVL ENFFKHSTRQ PLQTDIYGLA. It is sometimes possible for the material contained within the vial of "LASS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.