Western Blot (WB)
(WB Suggested Anti-SPATA5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)
Rabbit SPATA5 Polyclonal Antibody | anti-SPATA5 antibody
SPATA5 antibody - middle region
Gene Names
SPATA5; AFG2; SPAF; EHLMRS
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPATA5; Polyclonal Antibody; SPATA5 antibody - middle region; anti-SPATA5 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
Predicted Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
ALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL
Applicable Applications for anti-SPATA5 antibody
Western Blot (WB)
Protein Size (# AA)
893 amino acids
Protein Interactions
UBC;
Blocking Peptide
For anti-SPATA5 (MBS3210992) antibody is MBS3235945.
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SPATA5
Predicted Homology
Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SPATA5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)
Western Blot (WB)
(WB Suggested Anti-SPATA5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)
Related Product Information for anti-SPATA5 antibody
This is a rabbit polyclonal antibody against SPATA5. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis.
Target Description: SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis.
Product Categories/Family for anti-SPATA5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
ATPase family protein 2 homolog isoform 1
NCBI Official Synonym Full Names
spermatogenesis associated 5
NCBI Official Symbol
SPATA5
NCBI Official Synonym Symbols
AFG2; SPAF; EHLMRS
NCBI Protein Information
ATPase family protein 2 homolog; spermatogenesis-associated protein 5
UniProt Protein Name
Spermatogenesis-associated protein 5
Protein Family
UniProt Gene Name
SPATA5
UniProt Synonym Gene Names
AFG2; SPAF
UniProt Entry Name
SPAT5_HUMAN
NCBI Description
This gene encodes a member of the ATPase associated with diverse activities family, whose members are defined by a highly conserved ATPase domain. Members of this family participate in diverse cellular processes that include membrane fusion, DNA replication, microtubule severing, and protein degradation. The protein encoded by this gene has a putative mitochondrial targeting sequence and has been proposed to function in maintenance of mitochondrial function and integrity during mouse spermatogenesis. Allelic variants in this gene have been associated with epilepsy, hearing loss, and cognitive disability syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]
Research Articles on SPATA5
Similar Products
Product Notes
The SPATA5 spata5 (Catalog #AAA3210992) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPATA5 antibody - middle region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SPATA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPATA5 spata5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ALLALEEDIQ ANLIMKRHFT QALSTVTPRI PESLRRFYED YQEKSGLHTL. It is sometimes possible for the material contained within the vial of "SPATA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
