Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-JHDM1D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

Rabbit KDM7A Polyclonal Antibody | anti-KDM7A antibody

KDM7A Antibody - C region

Gene Names
KDM7A; JHDM1D
Reactivity
Dog, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KDM7A; Polyclonal Antibody; KDM7A Antibody - C region; anti-KDM7A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CGYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRV
Sequence Length
941
Applicable Applications for anti-KDM7A antibody
Western Blot (WB)
Homology
Dog: 85%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human JHDM1D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-JHDM1D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-JHDM1D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
Related Product Information for anti-KDM7A antibody
This is a rabbit polyclonal antibody against JHDM1D. It was validated on Western Blot using a cell lysate as a positive control.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106kDa
NCBI Official Full Name
lysine-specific demethylase 7A
NCBI Official Synonym Full Names
lysine demethylase 7A
NCBI Official Symbol
KDM7A
NCBI Official Synonym Symbols
JHDM1D
NCBI Protein Information
lysine-specific demethylase 7A
UniProt Protein Name
Lysine-specific demethylase 7
UniProt Gene Name
JHDM1D
UniProt Synonym Gene Names
KDM7; KIAA1718
UniProt Entry Name
KDM7_HUMAN

Uniprot Description

JHDM1D: Histone demethylase required for brain development. Specifically demethylates dimethylated 'Lys-9' and 'Lys-27' (H3K9me2 and H3K27me2, respectively) of histone H3 and monomethylated histone H4 'Lys-20' residue (H4K20Me1), thereby playing a central role in histone code. Specifically binds trimethylated 'Lys-4' of histone H3 (H3K4me3), affecting histone demethylase specificity: in presence of H3K4me3, it has no demethylase activity toward H3K9me2, while it has high activity toward H3K27me2. Demethylates H3K9me2 in absence of H3K4me3. Has activity toward H4K20Me1 only when nucleosome is used as a substrate and when not histone octamer is used as substrate. Belongs to the JHDM1 histone demethylase family. JHDM1D subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.14.11.-

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: nucleoplasm; nucleolus; nucleus

Molecular Function: zinc ion binding; histone demethylase activity (H3-K36 specific); iron ion binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors; histone demethylase activity (H3-K9 specific); methylated histone residue binding

Biological Process: establishment and/or maintenance of chromatin architecture; histone H3-K9 demethylation; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; midbrain development

Research Articles on KDM7A

Similar Products

Product Notes

The KDM7A jhdm1d (Catalog #AAA3213789) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KDM7A Antibody - C region reacts with Dog, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KDM7A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KDM7A jhdm1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CGYHVKTEDP DLRTSSWIKQ FDTSRFHPQD LSRSQKCIRK EGSSEISQRV. It is sometimes possible for the material contained within the vial of "KDM7A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.