Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chromatin Immunoprecipitation (ChIP) (Chromatin Immunoprecipitation (ChIP) Using JMJD5 antibody - middle region and HCT116 Cells)

Rabbit JMJD5 Polyclonal Antibody | anti-KDM8 antibody

JMJD5 antibody - middle region

Gene Names
KDM8; JMJD5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Western Blot
Purity
Affinity Purified
Synonyms
JMJD5; Polyclonal Antibody; JMJD5 antibody - middle region; anti-KDM8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAP
Sequence Length
416
Applicable Applications for anti-KDM8 antibody
Chromatin IP (ChIP), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human JMJD5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Chromatin Immunoprecipitation (ChIP)

(Chromatin Immunoprecipitation (ChIP) Using JMJD5 antibody - middle region and HCT116 Cells)

Chromatin Immunoprecipitation (ChIP) (Chromatin Immunoprecipitation (ChIP) Using JMJD5 antibody - middle region and HCT116 Cells)
Related Product Information for anti-KDM8 antibody
This is a rabbit polyclonal antibody against JMJD5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: JMJD5 is a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor.JMJD5 is a putative histone lysine demethylase that contains a Jumonji C (JmjC) domain (Shi, 2007 [PubMed 17909537]).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
bifunctional peptidase and arginyl-hydroxylase JMJD5 isoform 2
NCBI Official Synonym Full Names
lysine demethylase 8
NCBI Official Symbol
KDM8
NCBI Official Synonym Symbols
JMJD5
NCBI Protein Information
bifunctional peptidase and arginyl-hydroxylase JMJD5; jmjC domain-containing protein 5
UniProt Protein Name
Lysine-specific demethylase 8
UniProt Gene Name
KDM8
UniProt Synonym Gene Names
JMJD5
UniProt Entry Name
KDM8_HUMAN

NCBI Description

This gene likely encodes a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2009]

Uniprot Description

JMJD5: Histone demethylase required for G2/M phase cell cycle progression. Specifically demethylates dimethylated 'Lys-36' (H3K36me2) of histone H3, an epigenetic repressive mark, thereby acting as a transcription activator. Regulates expression of CCNA1 (cyclin-A1), leading to regulate cancer cell proliferation. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Demethylase; EC 1.14.11.27; Cell cycle regulation

Chromosomal Location of Human Ortholog: 16p12.1

Cellular Component: nucleus

Molecular Function: histone demethylase activity (H3-K36 specific); metal ion binding; chromatin binding

Biological Process: transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; G2/M transition of mitotic cell cycle

Research Articles on KDM8

Similar Products

Product Notes

The KDM8 kdm8 (Catalog #AAA3213748) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The JMJD5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's JMJD5 can be used in a range of immunoassay formats including, but not limited to, Chromatin IP (ChIP), Western Blot (WB). Researchers should empirically determine the suitability of the KDM8 kdm8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KYRPIQTPSV CSDSLESPDE DMGSDSDVTT ESGSSPSHSP EERQDPGSAP. It is sometimes possible for the material contained within the vial of "JMJD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.