Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit KANSL2 Polyclonal Antibody | anti-KANSL2 antibody

KANSL2 Antibody - N-terminal region

Gene Names
KANSL2; NSL2; C12orf41
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KANSL2; Polyclonal Antibody; KANSL2 Antibody - N-terminal region; anti-KANSL2 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSHPRLEGQEFCIKHILEDKNAPFKQCSYISTKNGKRCPNAAPKPEKKDG
Sequence Length
390
Applicable Applications for anti-KANSL2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Goat: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human KANSL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KANSL2Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/mlKANSL2 is supported by BioGPS gene expression data to be expressed in HeLa)

Related Product Information for anti-KANSL2 antibody
This is a rabbit polyclonal antibody against KANSL2. It was validated on Western Blot

Target Description: As part of the NSL complex KANSL2 is involved in acetylation of nucleosomal histone H4 on several lysine residues and therefore may be involved in the regulation of transcription.
Product Categories/Family for anti-KANSL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
KAT8 regulatory NSL complex subunit 2
NCBI Official Synonym Full Names
KAT8 regulatory NSL complex subunit 2
NCBI Official Symbol
KANSL2
NCBI Official Synonym Symbols
NSL2; C12orf41
NCBI Protein Information
KAT8 regulatory NSL complex subunit 2
UniProt Protein Name
KAT8 regulatory NSL complex subunit 2
UniProt Gene Name
KANSL2
UniProt Synonym Gene Names
C12orf41; NSL2
UniProt Entry Name
KANL2_HUMAN

Research Articles on KANSL2

Similar Products

Product Notes

The KANSL2 kansl2 (Catalog #AAA3217903) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KANSL2 Antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KANSL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KANSL2 kansl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSHPRLEGQE FCIKHILEDK NAPFKQCSYI STKNGKRCPN AAPKPEKKDG. It is sometimes possible for the material contained within the vial of "KANSL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual