Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SV422Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit KMT5C Polyclonal Antibody | anti-KMT5C antibody

KMT5C Antibody - N-terminal region

Gene Names
KMT5C; SUV420H2; Suv4-20h2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KMT5C; Polyclonal Antibody; KMT5C Antibody - N-terminal region; anti-KMT5C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLGGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMET
Sequence Length
462
Applicable Applications for anti-KMT5C antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SV422
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SV422Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SV422Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-KMT5C antibody
This is a rabbit polyclonal antibody against SV422. It was validated on Western Blot

Target Description: SUV420H2 and the related enzyme SUV420H1 (MIM 610881) function as histone methyltransferases that specifically trimethylate nucleosomal histone H4 (see MIM 602822) on lysine-20 (K20) (Schotta et al., 2004 [PubMed 15145825]).[supplied by OMIM, Dec 2009]
Product Categories/Family for anti-KMT5C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
SUV420H2 protein
NCBI Official Synonym Full Names
lysine methyltransferase 5C
NCBI Official Symbol
KMT5C
NCBI Official Synonym Symbols
SUV420H2; Suv4-20h2
NCBI Protein Information
histone-lysine N-methyltransferase KMT5C
UniProt Protein Name
Histone-lysine N-methyltransferase SUV420H2
UniProt Gene Name
SUV420H2
UniProt Synonym Gene Names
KMT5C
UniProt Entry Name
SV422_HUMAN

NCBI Description

SUV420H2 and the related enzyme SUV420H1 (MIM 610881) function as histone methyltransferases that specifically trimethylate nucleosomal histone H4 (see MIM 602822) on lysine-20 (K20) (Schotta et al., 2004 [PubMed 15145825]).[supplied by OMIM, Dec 2009]

Uniprot Description

SUV420H2: Histone methyltransferase that specifically trimethylates 'Lys-20' of histone H4. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions. SUV420H1 is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2). Belongs to the histone-lysine methyltransferase family. Suvar4-20 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Methyltransferase; EC 2.1.1.43; Amino Acid Metabolism - lysine degradation; Methyltransferase, protein lysine

Chromosomal Location of Human Ortholog: 19q13.42

Cellular Component: nucleoplasm; centric heterochromatin; nuclear heterochromatin; condensed nuclear chromosome, pericentric region

Molecular Function: protein binding; histone lysine N-methyltransferase activity (H4-K20 specific)

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Research Articles on KMT5C

Similar Products

Product Notes

The KMT5C suv420h2 (Catalog #AAA3210271) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KMT5C Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KMT5C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KMT5C suv420h2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLGGWTARYF QSRGPRQEAA LKTHVYRYLR AFLPESGFTI LPCTRYSMET. It is sometimes possible for the material contained within the vial of "KMT5C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.