Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KDM4ESample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit KDM4E Polyclonal Antibody | anti-KDM4E antibody

KDM4E Antibody - N-terminal region

Gene Names
KDM4E; KDM5E; JMJD2E; KDM4DL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KDM4E; Polyclonal Antibody; KDM4E Antibody - N-terminal region; anti-KDM4E antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YDDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQT
Sequence Length
506
Applicable Applications for anti-KDM4E antibody
Western Blot (WB)
Homology
Cow: 83%; Dog: 83%; Guinea Pig: 83%; Horse: 83%; Human: 100%; Mouse: 86%; Rabbit: 77%; Rat: 93%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human KDM4E
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KDM4ESample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KDM4ESample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-KDM4E antibody
This is a rabbit polyclonal antibody against KDM4E. It was validated on Western Blot

Target Description: KDM4E is a histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code.
Product Categories/Family for anti-KDM4E antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
lysine-specific demethylase 4E
NCBI Official Synonym Full Names
lysine demethylase 4E
NCBI Official Symbol
KDM4E
NCBI Official Synonym Symbols
KDM5E; JMJD2E; KDM4DL
NCBI Protein Information
lysine-specific demethylase 4E
UniProt Protein Name
Lysine-specific demethylase 4E
UniProt Gene Name
KDM4E
UniProt Synonym Gene Names
KDM4DL

NCBI Description

The protein encoded by this intronless gene is a member of a large family of histone lysine demethylases, which use oxygen and 2-oxoglutarate to demethylate di- and trimethylated lys9 of histone H3. Derepression of genes by demethylases is sometimes involved in viral infection or carcinogenesis, so inhibitors of these enzymes are desired. [provided by RefSeq, Dec 2016]

Uniprot Description

Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code.

Research Articles on KDM4E

Similar Products

Product Notes

The KDM4E kdm4e (Catalog #AAA3218557) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KDM4E Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KDM4E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KDM4E kdm4e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YDDIEDILIA TPLQQVTSGQ GGVFTQYHKK KKAMRVGQYR RLANSKKYQT. It is sometimes possible for the material contained within the vial of "KDM4E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.