Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SAP130Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlSAP130 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit SAP130 Polyclonal Antibody | anti-SAP130 antibody

SAP130 Antibody - C-terminal region

Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SAP130; Polyclonal Antibody; SAP130 Antibody - C-terminal region; anti-SAP130 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ANNLSMPTSDLPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEKSTAKS
Sequence Length
613
Applicable Applications for anti-SAP130 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SAP130
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SAP130Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlSAP130 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (Host: RabbitTarget Name: SAP130Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlSAP130 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-SAP130 antibody
This is a rabbit polyclonal antibody against SAP130. It was validated on Western Blot

Target Description: SAP130 is a subunit of the histone deacetylase-dependent SIN3A corepressor complex.
Product Categories/Family for anti-SAP130 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
Histone deacetylase complex subunit SAP130
NCBI Official Synonym Full Names
Sin3A associated protein 130
NCBI Official Symbol
SAP130
NCBI Protein Information
histone deacetylase complex subunit SAP130
UniProt Protein Name
Histone deacetylase complex subunit SAP130
UniProt Gene Name
SAP130
UniProt Entry Name
SP130_HUMAN

NCBI Description

SAP130 is a subunit of the histone deacetylase (see HDAC1; MIM 601241)-dependent SIN3A (MIM 607776) corepressor complex (Fleischer et al., 2003 [PubMed 12724404]).[supplied by OMIM, Mar 2008]

Uniprot Description

SAP130: Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. Belongs to the SAP130 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Acetyltransferase

Chromosomal Location of Human Ortholog: 2q14.3

Cellular Component: nucleoplasm

Molecular Function: histone acetyltransferase activity; transcription coactivator activity

Biological Process: establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; negative regulation of gene expression, epigenetic; gene expression; negative regulation of transcription from RNA polymerase II promoter; regulation of gene expression, epigenetic

Research Articles on SAP130

Similar Products

Product Notes

The SAP130 sap130 (Catalog #AAA3211500) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAP130 Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SAP130 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SAP130 sap130 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ANNLSMPTSD LPPGASPRKK PRKQQHVIST EEGDMMETNS TDDEKSTAKS. It is sometimes possible for the material contained within the vial of "SAP130, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.