Mouse anti-Human ISCA2 Polyclonal Antibody | anti-ISCA2 antibody

ISCA2 (HBLD1, Iron-sulfur Cluster Assembly 2 Homolog, Mitochondrial, HESB-like Domain-containing Protein 1)

Cat. Num. AAA6000205

• Gene Names: ISCA2; ISA2; HBLD1; c14_5557
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ISCA2; Polyclonal Antibody; ISCA2 (HBLD1; Iron-sulfur Cluster Assembly 2 Homolog; Mitochondrial; HESB-like Domain-containing Protein 1); Anti -ISCA2 (HBLD1; anti-ISCA2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ISCA2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKL

• Applicable Applications for anti-ISCA2 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human ISCA2, aa1-154 (NP_919255.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ISCA2 expression in transfected 293T cell line by ISCA2 polyclonal antibody. Lane 1: HBLD1 transfected lysate (16.94kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ISCA2 antibody

Involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.

Product Categories/Family for anti-ISCA2 antibody

Antibodies; Abs to Mitochondrial Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 432134254
• NCBI GeneID: 122961
• NCBI Accession #: NP_001258936.1
• NCBI GenBank Nucleotide #: NM_001272007.1
• UniProt Accession #: Q86U28; Q8IYZ0; Q96BB2; A6NFF1; A8K3W3
• Molecular Weight: 16,476 Da
• NCBI Official Full Name: iron-sulfur cluster assembly 2 homolog, mitochondrial isoform 2
• NCBI Official Synonym Full Names: iron-sulfur cluster assembly 2
• NCBI Official Symbol: ISCA2
• NCBI Official Synonym Symbols: ISA2; HBLD1; c14_5557
• NCBI Protein Information: iron-sulfur cluster assembly 2 homolog, mitochondrial; HESB-like domain-containing protein 1
• UniProt Protein Name: Iron-sulfur cluster assembly 2 homolog, mitochondrial
• Protein Family: Iron-sulfur cluster assembly
• UniProt Gene Name: ISCA2
• UniProt Synonym Gene Names: HBLD1
• UniProt Entry Name: ISCA2_HUMAN

NCBI Description

The protein encoded by this gene is an A-type iron-sulfur cluster (ISC) protein found in mitochondria. The encoded protein appears to be involved in the maturation of mitochondrial iron-sulfur proteins. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]

Uniprot Description

ISCA2: Involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly. Belongs to the HesB/IscA family.

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: mitochondrion

Molecular Function: metal ion binding; iron-sulfur cluster binding; structural molecule activity

Biological Process: iron-sulfur cluster assembly

Disease: Multiple Mitochondrial Dysfunctions Syndrome 4