Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (IL7 rabbit polyclonal antibody. Western Blot analysis of IL7 expression in human kidney.)

Rabbit anti-Human, Mouse Interleukin 7 Polyclonal Antibody | anti-IL-7 antibody

Interleukin 7 (Interleukin-7, IL7, IL-7) (FITC)

Gene Names
IL7; IL-7
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Interleukin 7; Polyclonal Antibody; Interleukin 7 (Interleukin-7; IL7; IL-7) (FITC); anti-IL-7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IL7. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-IL-7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human IL7, aa1-177 (AAH47698.1).
Immunogen Sequence
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(IL7 rabbit polyclonal antibody. Western Blot analysis of IL7 expression in human kidney.)

Western Blot (WB) (IL7 rabbit polyclonal antibody. Western Blot analysis of IL7 expression in human kidney.)

Western Blot (WB)

(IL7 rabbit polyclonal antibody. Western Blot analysis of IL7 expression in mouse kidney.)

Western Blot (WB) (IL7 rabbit polyclonal antibody. Western Blot analysis of IL7 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of IL7 expression in transfected 293T cell line by IL7 polyclonal antibody. Lane 1: IL7 transfected lysate (20.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IL7 expression in transfected 293T cell line by IL7 polyclonal antibody. Lane 1: IL7 transfected lysate (20.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-IL-7 antibody
IL-7 is a hematopoietic growth factor which affects primarily early B and T cells. Produced by thymic stromal cells, spleen cells and keratinocytes, IL-7 can also co-stimulate the proliferation of mature T cells in combination with other factors such as ConA and IL-2. Human and murine IL-7 is cross-species reactive.
Product Categories/Family for anti-IL-7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7,687 Da
NCBI Official Full Name
Interleukin 7
NCBI Official Synonym Full Names
interleukin 7
NCBI Official Symbol
IL7
NCBI Official Synonym Symbols
IL-7
NCBI Protein Information
interleukin-7
UniProt Protein Name
Interleukin-7
UniProt Gene Name
IL7
UniProt Synonym Gene Names
IL-7
UniProt Entry Name
IL7_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. This cytokine is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. Knockout studies in mice suggested that this cytokine plays an essential role in lymphoid cell survival. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their presence in normal tissues has not been confirmed.[provided by RefSeq, Dec 2010]

Uniprot Description

IL7: Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. Belongs to the IL-7/IL-9 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Cell cycle regulation; Secreted, signal peptide; Apoptosis; Cell development/differentiation; Cytokine

Chromosomal Location of Human Ortholog: 8q12-q13

Cellular Component: extracellular space; extracellular region

Molecular Function: interleukin-7 receptor binding; protein binding; growth factor activity; cytokine activity

Biological Process: positive regulation of organ growth; humoral immune response; T cell lineage commitment; organ morphogenesis; positive regulation of T cell differentiation; cell-cell signaling; regulation of gene expression; homeostasis of number of cells within a tissue; negative regulation of catalytic activity; positive regulation of cell proliferation; positive regulation of B cell proliferation; bone resorption; negative regulation of apoptosis

Research Articles on IL-7

Similar Products

Product Notes

The IL-7 il7 (Catalog #AAA6383028) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Interleukin 7 (Interleukin-7, IL7, IL-7) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Interleukin 7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL-7 il7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Interleukin 7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.