Western Blot (WB)
(Western blot-TP53I13 Polyclonal Antibody)
Rabbit anti-Mouse, Rat TP53I13 Polyclonal Antibody | anti-TP53I13 antibody
TP53I13 Polyclonal Antibody
Gene Names
TP53I13; DSCP1
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TP53I13; Polyclonal Antibody; TP53I13 Polyclonal Antibody; DSCP1; tumor protein p53-inducible protein 13; anti-TP53I13 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.51 mg/ml (varies by lot)
Sequence Length
393
Applicable Applications for anti-TP53I13 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 180-310 of human TP53I13 (NP_612358.3).
Immunogen Sequence
RSWRPPGTEVTSQGPRQPSSSGAKRRRLRAALGPQPTRSALRFPSASPGSLKAKQSMAGIPGRESNAPSVPTVSLLPGAPGGNASSRTEAQVPNGQGSPGGCVCSSQASPAPRAAAPPRAARGPTPRTEEA
Positive Samples
Mouse Liver, Mouse Brain, Rat Liver
Cellular Location
Cell Membrane, Cytoplasm, Extracellular Side, Single-Pass Type I Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-TP53I13 Polyclonal Antibody)
Western Blot (WB)
(Western blot-TP53I13 Polyclonal Antibody)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 42kDa
Observed: 55kDa
Observed: 55kDa
NCBI Official Full Name
tumor protein p53-inducible protein 13 isoform a
NCBI Official Synonym Full Names
tumor protein p53 inducible protein 13
NCBI Official Symbol
TP53I13
NCBI Official Synonym Symbols
DSCP1
NCBI Protein Information
tumor protein p53-inducible protein 13
UniProt Protein Name
Tumor protein p53-inducible protein 13
Protein Family
UniProt Gene Name
TP53I13
UniProt Synonym Gene Names
DSCP1
Uniprot Description
May act as a tumor suppressor. Inhibits tumor cell growth, when overexpressed.
Similar Products
Product Notes
The TP53I13 tp53i13 (Catalog #AAA9140617) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TP53I13 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TP53I13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TP53I13 tp53i13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TP53I13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
