Rabbit anti-Human, Mouse Interleukin 7 Polyclonal Antibody | anti-IL-7 antibody

Interleukin 7 (Interleukin-7, IL7, IL-7) (PE)

Cat. Num. AAA6383035

• Gene Names: IL7; IL-7
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Interleukin 7; Polyclonal Antibody; Interleukin 7 (Interleukin-7; IL7; IL-7) (PE); anti-IL-7 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human IL7. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-IL-7 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human IL7, aa1-177 (AAH47698.1).
• Immunogen Sequence: MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(IL7 rabbit polyclonal antibody. Western Blot analysis of IL7 expression in human kidney.)

Western Blot (WB)

(IL7 rabbit polyclonal antibody. Western Blot analysis of IL7 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of IL7 expression in transfected 293T cell line by IL7 polyclonal antibody. Lane 1: IL7 transfected lysate (20.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-IL-7 antibody

IL-7 is a hematopoietic growth factor which affects primarily early B and T cells. Produced by thymic stromal cells, spleen cells and keratinocytes, IL-7 can also co-stimulate the proliferation of mature T cells in combination with other factors such as ConA and IL-2. Human and murine IL-7 is cross-species reactive.

Product Categories/Family for anti-IL-7 antibody

Antibodies; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 29126905
• NCBI GeneID: 3574
• NCBI Accession #: AAH47698.1
• NCBI GenBank Nucleotide #: NM_000880
• UniProt Accession #: P13232; Q5FBY5; Q5FBY9; A0N0L3
• Molecular Weight: 7,687 Da
• NCBI Official Full Name: Interleukin 7
• NCBI Official Synonym Full Names: interleukin 7
• NCBI Official Symbol: IL7
• NCBI Official Synonym Symbols: IL-7
• NCBI Protein Information: interleukin-7
• UniProt Protein Name: Interleukin-7
• UniProt Gene Name: IL7
• UniProt Synonym Gene Names: IL-7
• UniProt Entry Name: IL7_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. This cytokine is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. Knockout studies in mice suggested that this cytokine plays an essential role in lymphoid cell survival. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their presence in normal tissues has not been confirmed.[provided by RefSeq, Dec 2010]

Uniprot Description

IL7: Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. Belongs to the IL-7/IL-9 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Cell cycle regulation; Secreted, signal peptide; Apoptosis; Cell development/differentiation; Cytokine

Chromosomal Location of Human Ortholog: 8q12-q13

Cellular Component: extracellular space; extracellular region

Molecular Function: interleukin-7 receptor binding; protein binding; growth factor activity; cytokine activity

Biological Process: positive regulation of organ growth; humoral immune response; T cell lineage commitment; organ morphogenesis; positive regulation of T cell differentiation; cell-cell signaling; regulation of gene expression; homeostasis of number of cells within a tissue; negative regulation of catalytic activity; positive regulation of cell proliferation; positive regulation of B cell proliferation; bone resorption; negative regulation of apoptosis