Rabbit anti-Mouse IL1RAP Polyclonal Antibody | anti-IL1RAP antibody

IL1RAP Antibody-C-terminal region

Cat. Num. AAA3249797

• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: IL1RAP; Polyclonal Antibody; IL1RAP Antibody-C-terminal region; interleukin-1 receptor accessory protein; AI255955; AV239853; IL-1RAcP; 6430709H04Rik; anti-IL1RAP antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
• Sequence: RAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRWSSNDKQGLSYS

• Applicable Applications for anti-IL1RAP antibody: Western Blot (WB)
• Protein Size: 570 amino acids
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse IL1RAP
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IL1RAPSample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-IL1RAP antibody

Description of Target: Coreceptor for IL1RL2 in the IL-36 signaling system. Coreceptor with IL1R1 in the IL-1 signaling system. Associates with IL1R1 bound to IL1B to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Recruits TOLLIP to the signaling complex. Does not bind to interleukin-1 alone; binding of IL1RN to IL1R1, prevents its association with IL1R1 to form a signaling complex. The cellular response is modulated through a non-signaling association with the membrane IL1R2 decoy receptor. Secreted forms (isoforms 2 and 3) associate with secreted ligand-bound IL1R2 and increase the affinity of secreted IL1R2 for IL1B; this complex formation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors. Coreceptor for IL1RL1 in the IL-33 signaling system. Can bidirectionally induce pre- and postsynaptic differentiation of neurons by trans-synaptically binding to PTPRD. May play a role in IL1B-mediated costimulation of IFNG production from T-helper 1 (Th1) cells (By similarity).

NCBI and Uniprot Product Information

• NCBI GeneID: 16180
• UniProt Accession #: Q61730; NP_001152790.1
• Molecular Weight: 62kDa
• UniProt Protein Name: Interleukin-1 receptor accessory protein
• Protein Family: Interleukin-1 receptor accessory protein
• UniProt Gene Name: Il1rap
• UniProt Synonym Gene Names: IL-1 receptor accessory protein; IL-1RAcP

Uniprot Description

Coreceptor for IL1RL2 in the IL-36 signaling system. Coreceptor with IL1R1 in the IL-1 signaling system. Associates with IL1R1 bound to IL1B to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Recruits TOLLIP to the signaling complex. Does not bind to interleukin-1 alone; binding of IL1RN to IL1R1, prevents its association with IL1R1 to form a signaling complex. The cellular response is modulated through a non-signaling association with the membrane IL1R2 decoy receptor. Secreted forms (isoforms 2 and 3) associate with secreted ligand-bound IL1R2 and increase the affinity of secreted IL1R2 for IL1B; this complex formation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors. Coreceptor for IL1RL1 in the IL-33 signaling system.