Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IL1RL1Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse IL1RL1 Polyclonal Antibody | anti-IL1RL1 antibody

IL1RL1 Antibody-C-terminal region

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL1RL1; Polyclonal Antibody; IL1RL1 Antibody-C-terminal region; interleukin-1 receptor-like 1; T1; St2; DER4; Ly84; ST2L; Fit-1; T1/ST2; St2-rs1; anti-IL1RL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
VGDLQDSLQHLVKIQGTIKWREDHVADKQSLSSKFWKHVRYQMPVPERAS
Applicable Applications for anti-IL1RL1 antibody
Western Blot (WB)
Protein Size
567 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse IL1RL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IL1RL1Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IL1RL1Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-IL1RL1 antibody
Description of Target: Receptor for interleukin-33 (IL-33); signaling requires association of the coreceptor IL1RAP. Its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8 (By similarity). Possibly involved in helper T-cell function.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
62kDa
UniProt Protein Name
Interleukin-1 receptor-like 1
Protein Family
UniProt Gene Name
Il1rl1
UniProt Synonym Gene Names
Ly84; St2; Ste2
UniProt Entry Name
ILRL1_MOUSE

Uniprot Description

IL1RL1: receptor for IL33. Its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of ERK1 and/or ERK2, p38-alpha, and JNK1. Apparently promotes the activation and differentiation of T-helper 2 cells. Belongs to the interleukin-1 receptor family. Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Three isoforms of the human protein are produced by alternative splicing. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and the liver. Isoform C is not detected in brain, heart, liver, kidney and skeletal muscle.

Protein type: Membrane protein, integral; Receptor, cytokine

Cellular Component: proteinaceous extracellular matrix; extracellular space; cell surface; membrane; integral to membrane; plasma membrane; extracellular region; external side of plasma membrane

Molecular Function: interleukin-1 receptor activity

Biological Process: negative regulation of cell proliferation; negative regulation of T-helper 1 type immune response; negative regulation of interferon-gamma production; negative regulation of I-kappaB kinase/NF-kappaB cascade; signal transduction; positive regulation of interleukin-5 production; positive regulation of macrophage activation; positive regulation of inflammatory response

Similar Products

Product Notes

The IL1RL1 il1rl1 (Catalog #AAA3249700) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL1RL1 Antibody-C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IL1RL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL1RL1 il1rl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VGDLQDSLQH LVKIQGTIKW REDHVADKQS LSSKFWKHVR YQMPVPERAS. It is sometimes possible for the material contained within the vial of "IL1RL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.