Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IGFALS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Rabbit IGFALS Polyclonal Antibody | anti-IGFALS antibody

IGFALS antibody - middle region

Gene Names
IGFALS; ALS; ACLSD
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IGFALS; Polyclonal Antibody; IGFALS antibody - middle region; anti-IGFALS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEG
Sequence Length
605
Applicable Applications for anti-IGFALS antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IGFALS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IGFALS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-IGFALS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Related Product Information for anti-IGFALS antibody
This is a rabbit polyclonal antibody against IGFALS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IGFALS is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in IGFALS are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
insulin-like growth factor-binding protein complex acid labile subunit isoform 2
NCBI Official Synonym Full Names
insulin like growth factor binding protein acid labile subunit
NCBI Official Symbol
IGFALS
NCBI Official Synonym Symbols
ALS; ACLSD
NCBI Protein Information
insulin-like growth factor-binding protein complex acid labile subunit
UniProt Protein Name
Insulin-like growth factor-binding protein complex acid labile subunit
UniProt Gene Name
IGFALS
UniProt Synonym Gene Names
ALS; ALS
UniProt Entry Name
ALS_HUMAN

NCBI Description

The protein encoded by this gene is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in this gene are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

IGFALS: Involved in protein-protein interactions that result in protein complexes, receptor-ligand binding or cell adhesion.

Protein type: Cell adhesion; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nucleoplasm; extracellular space; extracellular region

Molecular Function: insulin-like growth factor binding

Biological Process: cellular protein metabolic process; signal transduction; cell adhesion

Disease: Acid-labile Subunit Deficiency

Research Articles on IGFALS

Similar Products

Product Notes

The IGFALS igfals (Catalog #AAA3206242) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGFALS antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IGFALS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IGFALS igfals for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGLLGLRVLR LSHNAIASLR PRTFKDLHFL EELQLGHNRI RQLAERSFEG. It is sometimes possible for the material contained within the vial of "IGFALS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.